Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 2251230..2251771 Replicon chromosome
Accession NZ_CP102267
Organism Blautia wexlerae DSM 19850

Toxin (Protein)


Gene name relE Uniprot ID A0A174SDF0
Locus tag NQ550_RS10530 Protein ID WP_008703161.1
Coordinates 2251230..2251505 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A173Y879
Locus tag NQ550_RS10535 Protein ID WP_008703163.1
Coordinates 2251502..2251771 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQ550_RS10495 (NQ550_10495) 2247400..2247657 - 258 WP_008703150.1 hypothetical protein -
NQ550_RS10500 (NQ550_10500) 2247806..2248225 - 420 WP_008703153.1 hypothetical protein -
NQ550_RS10505 (NQ550_10505) 2248609..2249289 - 681 WP_008703154.1 site-specific integrase -
NQ550_RS10510 (NQ550_10510) 2249255..2249752 - 498 WP_008703156.1 hypothetical protein -
NQ550_RS10515 (NQ550_10515) 2249770..2250414 - 645 WP_025578420.1 hypothetical protein -
NQ550_RS10520 (NQ550_10520) 2250492..2250770 - 279 WP_025578419.1 hypothetical protein -
NQ550_RS10525 (NQ550_10525) 2250921..2251205 - 285 WP_025578417.1 DUF2442 domain-containing protein -
NQ550_RS10530 (NQ550_10530) 2251230..2251505 - 276 WP_008703161.1 type II toxin-antitoxin system YafQ family toxin Toxin
NQ550_RS10535 (NQ550_10535) 2251502..2251771 - 270 WP_008703163.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NQ550_RS10540 (NQ550_10540) 2252386..2252583 - 198 WP_008703164.1 hypothetical protein -
NQ550_RS10545 (NQ550_10545) 2252583..2252996 - 414 WP_029676927.1 HU family DNA-binding protein -
NQ550_RS10550 (NQ550_10550) 2253377..2253916 - 540 WP_025578415.1 hypothetical protein -
NQ550_RS10555 (NQ550_10555) 2254093..2255163 - 1071 WP_044996364.1 serine hydrolase -
NQ550_RS10560 (NQ550_10560) 2255289..2256449 - 1161 WP_025578412.1 FtsW/RodA/SpoVE family cell cycle protein -
NQ550_RS10565 (NQ550_10565) 2256443..2256730 - 288 WP_020993911.1 cell division topological specificity factor MinE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-87)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10826.49 Da        Isoelectric Point: 8.9710

>T253402 WP_008703161.1 NZ_CP102267:c2251505-2251230 [Blautia wexlerae DSM 19850]
MKYTVKPTSKFQKDLKRIQKRGYDMRLMTDIIKKLANGEILPPKNRDHNLSGNYSNCRECHIAPDWLLIYEVYEDELFLY
LTRTGSHSDLF

Download         Length: 276 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10094.55 Da        Isoelectric Point: 4.2958

>AT253402 WP_008703163.1 NZ_CP102267:c2251771-2251502 [Blautia wexlerae DSM 19850]
MANVSIRMDDNLKKQAEDLFNDLGMNLTTAFTIFVKQAIREQGIPFEITREIPNSETISAINEVQQMKQNPSLGKAYTDV
DKMMEELLA

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A174SDF0

Antitoxin

Source ID Structure
AlphaFold DB A0A173Y879

References