Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 2405311..2405876 Replicon chromosome
Accession NZ_CP102266
Organism Blautia sp. KLE_1732_HM_1032

Toxin (Protein)


Gene name relE Uniprot ID U2EJ07
Locus tag NQ489_RS11500 Protein ID WP_021651024.1
Coordinates 2405311..2405601 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NQ489_RS11505 Protein ID WP_044961236.1
Coordinates 2405598..2405876 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQ489_RS11470 (NQ489_11470) 2400443..2401357 + 915 WP_014081148.1 HAMP domain-containing sensor histidine kinase -
NQ489_RS11475 (NQ489_11475) 2401813..2402226 + 414 WP_014081146.1 sigma factor-like helix-turn-helix DNA-binding protein -
NQ489_RS11480 (NQ489_11480) 2402330..2402782 + 453 WP_021650281.1 hypothetical protein -
NQ489_RS11485 (NQ489_11485) 2402793..2403254 + 462 WP_009296689.1 sigma factor-like helix-turn-helix DNA-binding protein -
NQ489_RS11490 (NQ489_11490) 2403283..2403573 + 291 WP_014081144.1 DUF3847 domain-containing protein -
NQ489_RS11495 (NQ489_11495) 2403788..2405233 + 1446 WP_014081143.1 MobQ family relaxase -
NQ489_RS11500 (NQ489_11500) 2405311..2405601 - 291 WP_021651024.1 type II toxin-antitoxin system YafQ family toxin Toxin
NQ489_RS11505 (NQ489_11505) 2405598..2405876 - 279 WP_044961236.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NQ489_RS11510 (NQ489_11510) 2406003..2406401 + 399 WP_014081140.1 cysteine-rich VLP domain-containing protein -
NQ489_RS11515 (NQ489_11515) 2406515..2407249 + 735 WP_021651027.1 phage replisome organizer N-terminal domain-containing protein -
NQ489_RS11520 (NQ489_11520) 2407246..2408109 + 864 WP_014081138.1 ATP-binding protein -
NQ489_RS11525 (NQ489_11525) 2408153..2408347 + 195 WP_014081137.1 transposon-encoded TnpW family protein -
NQ489_RS11530 (NQ489_11530) 2408425..2408790 + 366 WP_014081136.1 hypothetical protein -
NQ489_RS11535 (NQ489_11535) 2408748..2409983 - 1236 WP_227945525.1 DNA topoisomerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2396947..2408790 11843


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(6-95)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-70)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11139.94 Da        Isoelectric Point: 9.4307

>T253401 WP_021651024.1 NZ_CP102266:c2405601-2405311 [Blautia sp. KLE_1732_HM_1032]
MRKTKYTVKYTTAFKKDYKRAIKRGLKIELLEQVVALLSMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK

Download         Length: 291 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10173.64 Da        Isoelectric Point: 4.4692

>AT253401 WP_044961236.1 NZ_CP102266:c2405876-2405598 [Blautia sp. KLE_1732_HM_1032]
MAGNTTNISIRMDADLKAQADALFTELGMNLTTAFNIFVRQSLREGGIPFEVRLEQPNKETIAAMLEAERIAKDPSVKGC
NDLDELFADLKK

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U2EJ07

Antitoxin

Source ID Structure

References