Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 2250270..2250817 | Replicon | chromosome |
Accession | NZ_CP102265 | ||
Organism | Blautia obeum ATCC 29174 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A395X9D1 |
Locus tag | NQ503_RS10900 | Protein ID | WP_005422163.1 |
Coordinates | 2250536..2250817 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A395X9D2 |
Locus tag | NQ503_RS10895 | Protein ID | WP_005422165.1 |
Coordinates | 2250270..2250539 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ503_RS10870 (NQ503_10870) | 2245411..2246316 | - | 906 | WP_005422173.1 | hypothetical protein | - |
NQ503_RS10875 (NQ503_10875) | 2246338..2248101 | - | 1764 | WP_005422171.1 | YARHG domain-containing protein | - |
NQ503_RS10880 (NQ503_10880) | 2248126..2248452 | - | 327 | WP_005422170.1 | hypothetical protein | - |
NQ503_RS10885 (NQ503_10885) | 2248497..2249645 | - | 1149 | WP_005422168.1 | permease-like cell division protein FtsX | - |
NQ503_RS10890 (NQ503_10890) | 2249781..2250107 | + | 327 | WP_044924801.1 | helix-turn-helix transcriptional regulator | - |
NQ503_RS10895 (NQ503_10895) | 2250270..2250539 | + | 270 | WP_005422165.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NQ503_RS10900 (NQ503_10900) | 2250536..2250817 | + | 282 | WP_005422163.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
NQ503_RS10905 (NQ503_10905) | 2251083..2255315 | - | 4233 | WP_022388823.1 | 2-hydroxyacyl-CoA dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10991.74 Da Isoelectric Point: 9.3370
>T253400 WP_005422163.1 NZ_CP102265:2250536-2250817 [Blautia obeum ATCC 29174]
MKYSIKPTSKFQKDLKRIQKRGYDLSLLSDVIKKLSNGESLPLKYRDHNLIGNFCGCRECHITPDWLLIYEIYEKDLYLY
LTRTGSHSDLFSK
MKYSIKPTSKFQKDLKRIQKRGYDLSLLSDVIKKLSNGESLPLKYRDHNLIGNFCGCRECHITPDWLLIYEIYEKDLYLY
LTRTGSHSDLFSK
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A395X9D1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A395X9D2 |