Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 876296..876846 | Replicon | chromosome |
Accession | NZ_CP102264 | ||
Organism | Blautia hansenii DSM 20583 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C9LBU6 |
Locus tag | NQ538_RS04440 | Protein ID | WP_004223437.1 |
Coordinates | 876565..876846 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | C9LBU7 |
Locus tag | NQ538_RS04435 | Protein ID | WP_004223440.1 |
Coordinates | 876296..876568 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ538_RS04415 (NQ538_04415) | 871628..873148 | + | 1521 | WP_009246857.1 | ABC transporter ATP-binding protein | - |
NQ538_RS04420 (NQ538_04420) | 873150..874238 | + | 1089 | WP_040351279.1 | ABC transporter permease | - |
NQ538_RS04425 (NQ538_04425) | 874238..875185 | + | 948 | WP_089438666.1 | ABC transporter permease | - |
NQ538_RS04430 (NQ538_04430) | 875194..876153 | + | 960 | WP_004223441.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
NQ538_RS04435 (NQ538_04435) | 876296..876568 | + | 273 | WP_004223440.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NQ538_RS04440 (NQ538_04440) | 876565..876846 | + | 282 | WP_004223437.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
NQ538_RS04445 (NQ538_04445) | 876912..877406 | - | 495 | WP_004223436.1 | VanZ family protein | - |
NQ538_RS04450 (NQ538_04450) | 877550..878401 | + | 852 | WP_004223433.1 | thymidylate synthase | - |
NQ538_RS04455 (NQ538_04455) | 878415..878903 | + | 489 | WP_004223430.1 | dihydrofolate reductase | - |
NQ538_RS04460 (NQ538_04460) | 879054..879887 | - | 834 | WP_004223427.1 | LarC family nickel insertion protein | - |
NQ538_RS04465 (NQ538_04465) | 879906..880940 | - | 1035 | WP_004223424.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10925.81 Da Isoelectric Point: 7.2752
>T253399 WP_004223437.1 NZ_CP102264:876565-876846 [Blautia hansenii DSM 20583]
MMYDLILTGKFKKSLKLAKKRGLNISLLEEVVNILQSGEELDKKYRDHELKGKYKNFRECHIQPDWLLIYLIENDILTLT
LVDTGTHADLFNM
MMYDLILTGKFKKSLKLAKKRGLNISLLEEVVNILQSGEELDKKYRDHELKGKYKNFRECHIQPDWLLIYLIENDILTLT
LVDTGTHADLFNM
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|