Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-yefM/Txe-RelB |
| Location | 2528277..2528830 | Replicon | chromosome |
| Accession | NZ_CP102262 | ||
| Organism | Bacteroides stercoris ATCC 43183 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | B0NMA6 |
| Locus tag | NQ565_RS10395 | Protein ID | WP_005653177.1 |
| Coordinates | 2528277..2528552 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | B0NMA5 |
| Locus tag | NQ565_RS10400 | Protein ID | WP_005653175.1 |
| Coordinates | 2528540..2528830 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ565_RS10355 (NQ565_10355) | 2524105..2524629 | + | 525 | WP_005653195.1 | hypothetical protein | - |
| NQ565_RS10360 (NQ565_10360) | 2524659..2524811 | + | 153 | WP_155817343.1 | hypothetical protein | - |
| NQ565_RS10365 (NQ565_10365) | 2524920..2525099 | - | 180 | WP_005653191.1 | hypothetical protein | - |
| NQ565_RS10370 (NQ565_10370) | 2525294..2526058 | - | 765 | WP_005653189.1 | phage regulatory protein/antirepressor Ant | - |
| NQ565_RS10375 (NQ565_10375) | 2526381..2526632 | + | 252 | WP_005653186.1 | hypothetical protein | - |
| NQ565_RS10380 (NQ565_10380) | 2526629..2526880 | + | 252 | WP_005653184.1 | DUF4160 domain-containing protein | - |
| NQ565_RS10385 (NQ565_10385) | 2526893..2527132 | + | 240 | WP_005653183.1 | DUF2442 domain-containing protein | - |
| NQ565_RS10390 (NQ565_10390) | 2527317..2528009 | + | 693 | WP_040315581.1 | DUF4468 domain-containing protein | - |
| NQ565_RS10395 (NQ565_10395) | 2528277..2528552 | - | 276 | WP_005653177.1 | Txe/YoeB family addiction module toxin | Toxin |
| NQ565_RS10400 (NQ565_10400) | 2528540..2528830 | - | 291 | WP_005653175.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NQ565_RS10405 (NQ565_10405) | 2529016..2529468 | + | 453 | WP_005653174.1 | hypothetical protein | - |
| NQ565_RS10410 (NQ565_10410) | 2529522..2530172 | + | 651 | WP_005653172.1 | hypothetical protein | - |
| NQ565_RS10415 (NQ565_10415) | 2530355..2530537 | - | 183 | WP_005653170.1 | hypothetical protein | - |
| NQ565_RS10420 (NQ565_10420) | 2530554..2530853 | - | 300 | WP_005653169.1 | hypothetical protein | - |
| NQ565_RS10425 (NQ565_10425) | 2531021..2531281 | + | 261 | WP_005653168.1 | helix-turn-helix transcriptional regulator | - |
| NQ565_RS10430 (NQ565_10430) | 2531327..2531584 | + | 258 | WP_005653166.1 | DUF4160 domain-containing protein | - |
| NQ565_RS10435 (NQ565_10435) | 2531591..2531824 | + | 234 | WP_040315588.1 | DUF2442 domain-containing protein | - |
| NQ565_RS10440 (NQ565_10440) | 2532287..2532673 | + | 387 | WP_016662801.1 | HEPN domain-containing protein | - |
| NQ565_RS10445 (NQ565_10445) | 2532652..2532948 | + | 297 | WP_005653159.1 | nucleotidyltransferase domain-containing protein | - |
| NQ565_RS10450 (NQ565_10450) | 2533207..2533557 | + | 351 | WP_005652161.1 | transposase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10673.34 Da Isoelectric Point: 9.9529
>T253398 WP_005653177.1 NZ_CP102262:c2528552-2528277 [Bacteroides stercoris ATCC 43183]
MYKITLSAQAKEEYQYFVRSGNKAIINKILSLLEDIAKHPYTGIGKPESLKYDLSGKWSRRINSEHRIIYSVNDEIITVY
VLSMRYHYGKK
MYKITLSAQAKEEYQYFVRSGNKAIINKILSLLEDIAKHPYTGIGKPESLKYDLSGKWSRRINSEHRIIYSVNDEIITVY
VLSMRYHYGKK
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|