Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4724171..4724778 | Replicon | chromosome |
| Accession | NZ_CP102247 | ||
| Organism | Enterobacter asburiae strain R_A5.MM | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7H0N5B9 |
| Locus tag | NQ230_RS22430 | Protein ID | WP_071993467.1 |
| Coordinates | 4724593..4724778 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A155E9Y3 |
| Locus tag | NQ230_RS22425 | Protein ID | WP_032675741.1 |
| Coordinates | 4724171..4724578 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ230_RS22405 (NQ230_22405) | 4720541..4721194 | + | 654 | WP_257259293.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| NQ230_RS22410 (NQ230_22410) | 4721197..4722057 | + | 861 | WP_257259297.1 | L-ribulose-5-phosphate 3-epimerase | - |
| NQ230_RS22415 (NQ230_22415) | 4722051..4722746 | + | 696 | WP_257259301.1 | L-ribulose-5-phosphate 4-epimerase | - |
| NQ230_RS22420 (NQ230_22420) | 4723092..4724167 | + | 1076 | Protein_4369 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| NQ230_RS22425 (NQ230_22425) | 4724171..4724578 | - | 408 | WP_032675741.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NQ230_RS22430 (NQ230_22430) | 4724593..4724778 | - | 186 | WP_071993467.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NQ230_RS22435 (NQ230_22435) | 4724988..4725728 | - | 741 | WP_213822179.1 | MipA/OmpV family protein | - |
| NQ230_RS22440 (NQ230_22440) | 4725846..4726811 | + | 966 | WP_121425999.1 | LysR family transcriptional regulator | - |
| NQ230_RS22445 (NQ230_22445) | 4726808..4728346 | - | 1539 | WP_029740992.1 | aldehyde dehydrogenase AldB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6882.06 Da Isoelectric Point: 11.2341
>T253397 WP_071993467.1 NZ_CP102247:c4724778-4724593 [Enterobacter asburiae]
VKSADVITVLISHGWKCVRTKGSHHQFRHPEQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITVLISHGWKCVRTKGSHHQFRHPEQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15010.78 Da Isoelectric Point: 4.3897
>AT253397 WP_032675741.1 NZ_CP102247:c4724578-4724171 [Enterobacter asburiae]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDNALPLPGNVEAHLESRPEDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPG
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDNALPLPGNVEAHLESRPEDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPG
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H0N5B9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A155E9Y3 |