Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4263443..4264019 | Replicon | chromosome |
| Accession | NZ_CP102247 | ||
| Organism | Enterobacter asburiae strain R_A5.MM | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A4R0G892 |
| Locus tag | NQ230_RS20265 | Protein ID | WP_010427219.1 |
| Coordinates | 4263732..4264019 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | NQ230_RS20260 | Protein ID | WP_257258848.1 |
| Coordinates | 4263443..4263745 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ230_RS20240 (NQ230_20240) | 4259748..4260293 | + | 546 | WP_063143257.1 | YfaZ family outer membrane protein | - |
| NQ230_RS20245 (NQ230_20245) | 4260461..4261831 | - | 1371 | WP_257258844.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| NQ230_RS20250 (NQ230_20250) | 4261983..4262726 | + | 744 | WP_257258845.1 | AraC family transcriptional regulator | - |
| NQ230_RS20255 (NQ230_20255) | 4262774..4263412 | + | 639 | WP_257258847.1 | LysE family translocator | - |
| NQ230_RS20260 (NQ230_20260) | 4263443..4263745 | - | 303 | WP_257258848.1 | BrnA antitoxin family protein | Antitoxin |
| NQ230_RS20265 (NQ230_20265) | 4263732..4264019 | - | 288 | WP_010427219.1 | BrnT family toxin | Toxin |
| NQ230_RS20270 (NQ230_20270) | 4264190..4265461 | + | 1272 | WP_257258849.1 | DUF445 domain-containing protein | - |
| NQ230_RS20275 (NQ230_20275) | 4265458..4266534 | - | 1077 | WP_257258850.1 | DUF2955 domain-containing protein | - |
| NQ230_RS20280 (NQ230_20280) | 4266524..4267591 | - | 1068 | WP_121424942.1 | HlyD family secretion protein | - |
| NQ230_RS20285 (NQ230_20285) | 4267588..4268058 | - | 471 | WP_257258851.1 | MarR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4268283..4269425 | 1142 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11174.64 Da Isoelectric Point: 6.7609
>T253396 WP_010427219.1 NZ_CP102247:c4264019-4263732 [Enterobacter asburiae]
MPTEFEWDTNKAKSNLIKHGIRFEEAVLVFDDPYHLSLQDRHENGEFRWQTIGLVHGLIVIMVAHTVRFESGDEVIRIIS
ARKADRKERSRYEHG
MPTEFEWDTNKAKSNLIKHGIRFEEAVLVFDDPYHLSLQDRHENGEFRWQTIGLVHGLIVIMVAHTVRFESGDEVIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|