Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3796461..3797081 | Replicon | chromosome |
| Accession | NZ_CP102247 | ||
| Organism | Enterobacter asburiae strain R_A5.MM | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1H8SI38 |
| Locus tag | NQ230_RS18115 | Protein ID | WP_008499287.1 |
| Coordinates | 3796863..3797081 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | NQ230_RS18110 | Protein ID | WP_008499288.1 |
| Coordinates | 3796461..3796835 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ230_RS18100 (NQ230_18100) | 3791588..3792781 | + | 1194 | WP_023310601.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NQ230_RS18105 (NQ230_18105) | 3792804..3795950 | + | 3147 | WP_063145542.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NQ230_RS18110 (NQ230_18110) | 3796461..3796835 | + | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| NQ230_RS18115 (NQ230_18115) | 3796863..3797081 | + | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
| NQ230_RS18120 (NQ230_18120) | 3797287..3797838 | + | 552 | WP_159513576.1 | maltose O-acetyltransferase | - |
| NQ230_RS18125 (NQ230_18125) | 3797956..3798423 | + | 468 | WP_121425576.1 | YlaC family protein | - |
| NQ230_RS18130 (NQ230_18130) | 3798395..3799855 | - | 1461 | WP_257258529.1 | PLP-dependent aminotransferase family protein | - |
| NQ230_RS18135 (NQ230_18135) | 3799957..3800667 | + | 711 | WP_257258530.1 | GNAT family protein | - |
| NQ230_RS18140 (NQ230_18140) | 3800664..3800804 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| NQ230_RS18145 (NQ230_18145) | 3800807..3801067 | - | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T253395 WP_008499287.1 NZ_CP102247:3796863-3797081 [Enterobacter asburiae]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT253395 WP_008499288.1 NZ_CP102247:3796461-3796835 [Enterobacter asburiae]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8SI38 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |