Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1442183..1442979 Replicon chromosome
Accession NZ_CP102247
Organism Enterobacter asburiae strain R_A5.MM

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NQ230_RS06910 Protein ID WP_257260565.1
Coordinates 1442183..1442575 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NQ230_RS06915 Protein ID WP_257260566.1
Coordinates 1442632..1442979 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQ230_RS06880 (NQ230_06880) 1437710..1438165 + 456 WP_257260558.1 type VI secretion system baseplate subunit TssE -
NQ230_RS06885 (NQ230_06885) 1438180..1438650 + 471 WP_257260559.1 hypothetical protein -
NQ230_RS06890 (NQ230_06890) 1438716..1439117 + 402 WP_257260560.1 hypothetical protein -
NQ230_RS06895 (NQ230_06895) 1439190..1440434 + 1245 WP_257260561.1 GIY-YIG nuclease family protein -
NQ230_RS06900 (NQ230_06900) 1440479..1441825 + 1347 WP_257260563.1 VasL domain-containing protein -
NQ230_RS06905 (NQ230_06905) 1442082..1442198 - 117 Protein_1328 DUF5983 family protein -
NQ230_RS06910 (NQ230_06910) 1442183..1442575 - 393 WP_257260565.1 toxin Toxin
NQ230_RS06915 (NQ230_06915) 1442632..1442979 - 348 WP_257260566.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NQ230_RS06920 (NQ230_06920) 1443018..1443239 - 222 WP_257260567.1 DUF987 domain-containing protein -
NQ230_RS06925 (NQ230_06925) 1443259..1443738 - 480 WP_257260568.1 DNA repair protein RadC -
NQ230_RS06930 (NQ230_06930) 1443750..1444232 - 483 WP_257260569.1 antirestriction protein -
NQ230_RS06935 (NQ230_06935) 1444444..1444590 - 147 Protein_1334 DUF945 domain-containing protein -
NQ230_RS06940 (NQ230_06940) 1444954..1445469 - 516 WP_257260570.1 hypothetical protein -
NQ230_RS06945 (NQ230_06945) 1445586..1446137 - 552 WP_257260572.1 hypothetical protein -
NQ230_RS06950 (NQ230_06950) 1446440..1447321 - 882 WP_257260574.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - icmF/tssM / tssF / tssG / sciN/tssJ 1422070..1487757 65687


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-109)

Antitoxin

Antitoxin CbeA

(9-108)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14686.86 Da        Isoelectric Point: 9.0061

>T253389 WP_257260565.1 NZ_CP102247:c1442575-1442183 [Enterobacter asburiae]
MQTLSAISVRKAPPHPTPVEIWQQLLTYLLERHYGLSLHDTQFGDGNVIQQHIDAGISLADALNFLVEKSELVRIDRPGF
SFHLQSAFIGTIDILRARRATGLMQRFGYKRITHIIAGKAAQEQHSWNCP

Download         Length: 393 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 12845.73 Da        Isoelectric Point: 6.9459

>AT253389 WP_257260566.1 NZ_CP102247:c1442979-1442632 [Enterobacter asburiae]
MQQIMTAEPWWGLRRNITPCFGARLVQEGNCLHYLADRASIAGTFSDADLRHLDQAFQVLLKQLELMLVSGELNPRHQHC
VTLYAKGLTCEADSLGSHGYIYIAIYPTSGNGIPR

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References