Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 928246..928903 | Replicon | chromosome |
| Accession | NZ_CP102247 | ||
| Organism | Enterobacter asburiae strain R_A5.MM | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
| Locus tag | NQ230_RS04535 | Protein ID | WP_021242050.1 |
| Coordinates | 928493..928903 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V3PWU7 |
| Locus tag | NQ230_RS04530 | Protein ID | WP_010435322.1 |
| Coordinates | 928246..928512 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ230_RS04510 (NQ230_04510) | 923690..925123 | - | 1434 | WP_252033567.1 | 6-phospho-beta-glucosidase BglA | - |
| NQ230_RS04515 (NQ230_04515) | 925240..925971 | - | 732 | WP_121424592.1 | MurR/RpiR family transcriptional regulator | - |
| NQ230_RS04520 (NQ230_04520) | 926237..926896 | + | 660 | WP_023333307.1 | hemolysin III family protein | - |
| NQ230_RS04525 (NQ230_04525) | 926971..927951 | - | 981 | WP_121424591.1 | tRNA-modifying protein YgfZ | - |
| NQ230_RS04530 (NQ230_04530) | 928246..928512 | + | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
| NQ230_RS04535 (NQ230_04535) | 928493..928903 | + | 411 | WP_021242050.1 | protein YgfX | Toxin |
| NQ230_RS04540 (NQ230_04540) | 928910..929431 | - | 522 | WP_023333304.1 | flavodoxin FldB | - |
| NQ230_RS04545 (NQ230_04545) | 929533..930429 | + | 897 | WP_023309098.1 | site-specific tyrosine recombinase XerD | - |
| NQ230_RS04550 (NQ230_04550) | 930458..931171 | + | 714 | WP_029740340.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NQ230_RS04555 (NQ230_04555) | 931177..932910 | + | 1734 | WP_121424590.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T253388 WP_021242050.1 NZ_CP102247:928493-928903 [Enterobacter asburiae]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PWU7 |