Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4939630..4940234 | Replicon | chromosome |
| Accession | NZ_CP102246 | ||
| Organism | Enterobacter cloacae complex sp. R_G8 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A421IJD5 |
| Locus tag | NQ842_RS23295 | Protein ID | WP_071843252.1 |
| Coordinates | 4940049..4940234 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A5E1AFC9 |
| Locus tag | NQ842_RS23290 | Protein ID | WP_023621194.1 |
| Coordinates | 4939630..4940034 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ842_RS23275 (NQ842_23275) | 4935165..4935983 | - | 819 | WP_194516699.1 | helix-turn-helix domain-containing protein | - |
| NQ842_RS23280 (NQ842_23280) | 4936208..4937608 | + | 1401 | WP_063427592.1 | MFS transporter | - |
| NQ842_RS23285 (NQ842_23285) | 4937619..4939574 | + | 1956 | WP_257256379.1 | glycoside hydrolase family 127 protein | - |
| NQ842_RS23290 (NQ842_23290) | 4939630..4940034 | - | 405 | WP_023621194.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NQ842_RS23295 (NQ842_23295) | 4940049..4940234 | - | 186 | WP_071843252.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NQ842_RS23300 (NQ842_23300) | 4940445..4941185 | - | 741 | WP_063411373.1 | MipA/OmpV family protein | - |
| NQ842_RS23305 (NQ842_23305) | 4941303..4942269 | + | 967 | Protein_4545 | LysR family transcriptional regulator | - |
| NQ842_RS23310 (NQ842_23310) | 4942266..4943804 | - | 1539 | WP_257256381.1 | aldehyde dehydrogenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6859.08 Da Isoelectric Point: 11.7891
>T253387 WP_071843252.1 NZ_CP102246:c4940234-4940049 [Enterobacter cloacae complex sp. R_G8]
VKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14888.72 Da Isoelectric Point: 4.3036
>AT253387 WP_023621194.1 NZ_CP102246:c4940034-4939630 [Enterobacter cloacae complex sp. R_G8]
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVSEHPQFSNRSAFLAEAARRVLP
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVSEHPQFSNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A421IJD5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E1AFC9 |