Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3967439..3968059 | Replicon | chromosome |
| Accession | NZ_CP102246 | ||
| Organism | Enterobacter cloacae complex sp. R_G8 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A5E1A1U8 |
| Locus tag | NQ842_RS18860 | Protein ID | WP_013095889.1 |
| Coordinates | 3967841..3968059 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | NQ842_RS18855 | Protein ID | WP_008499288.1 |
| Coordinates | 3967439..3967813 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ842_RS18845 (NQ842_18845) | 3962564..3963757 | + | 1194 | WP_014830903.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NQ842_RS18850 (NQ842_18850) | 3963780..3966926 | + | 3147 | WP_014830902.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NQ842_RS18855 (NQ842_18855) | 3967439..3967813 | + | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| NQ842_RS18860 (NQ842_18860) | 3967841..3968059 | + | 219 | WP_013095889.1 | HHA domain-containing protein | Toxin |
| NQ842_RS18865 (NQ842_18865) | 3968269..3968820 | + | 552 | WP_014830901.1 | maltose O-acetyltransferase | - |
| NQ842_RS18870 (NQ842_18870) | 3968936..3969403 | + | 468 | WP_013095887.1 | YlaC family protein | - |
| NQ842_RS18875 (NQ842_18875) | 3969375..3970835 | - | 1461 | WP_257256199.1 | PLP-dependent aminotransferase family protein | - |
| NQ842_RS18880 (NQ842_18880) | 3970937..3971647 | + | 711 | WP_014830898.1 | GNAT family protein | - |
| NQ842_RS18885 (NQ842_18885) | 3971644..3971784 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| NQ842_RS18890 (NQ842_18890) | 3971787..3972047 | - | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8625.98 Da Isoelectric Point: 8.9008
>T253386 WP_013095889.1 NZ_CP102246:3967841-3968059 [Enterobacter cloacae complex sp. R_G8]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT253386 WP_008499288.1 NZ_CP102246:3967439-3967813 [Enterobacter cloacae complex sp. R_G8]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E1A1U8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |