Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3967439..3968059 Replicon chromosome
Accession NZ_CP102246
Organism Enterobacter cloacae complex sp. R_G8

Toxin (Protein)


Gene name Hha Uniprot ID A0A5E1A1U8
Locus tag NQ842_RS18860 Protein ID WP_013095889.1
Coordinates 3967841..3968059 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID V3PBI9
Locus tag NQ842_RS18855 Protein ID WP_008499288.1
Coordinates 3967439..3967813 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQ842_RS18845 (NQ842_18845) 3962564..3963757 + 1194 WP_014830903.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NQ842_RS18850 (NQ842_18850) 3963780..3966926 + 3147 WP_014830902.1 multidrug efflux RND transporter permease subunit AcrB -
NQ842_RS18855 (NQ842_18855) 3967439..3967813 + 375 WP_008499288.1 Hha toxicity modulator TomB Antitoxin
NQ842_RS18860 (NQ842_18860) 3967841..3968059 + 219 WP_013095889.1 HHA domain-containing protein Toxin
NQ842_RS18865 (NQ842_18865) 3968269..3968820 + 552 WP_014830901.1 maltose O-acetyltransferase -
NQ842_RS18870 (NQ842_18870) 3968936..3969403 + 468 WP_013095887.1 YlaC family protein -
NQ842_RS18875 (NQ842_18875) 3969375..3970835 - 1461 WP_257256199.1 PLP-dependent aminotransferase family protein -
NQ842_RS18880 (NQ842_18880) 3970937..3971647 + 711 WP_014830898.1 GNAT family protein -
NQ842_RS18885 (NQ842_18885) 3971644..3971784 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
NQ842_RS18890 (NQ842_18890) 3971787..3972047 - 261 WP_010428154.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8625.98 Da        Isoelectric Point: 8.9008

>T253386 WP_013095889.1 NZ_CP102246:3967841-3968059 [Enterobacter cloacae complex sp. R_G8]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14481.28 Da        Isoelectric Point: 4.8886

>AT253386 WP_008499288.1 NZ_CP102246:3967439-3967813 [Enterobacter cloacae complex sp. R_G8]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5E1A1U8

Antitoxin

Source ID Structure
AlphaFold DB V3PBI9

References