Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1939914..1940504 | Replicon | chromosome |
| Accession | NZ_CP102246 | ||
| Organism | Enterobacter cloacae complex sp. R_G8 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A427KSR1 |
| Locus tag | NQ842_RS09165 | Protein ID | WP_047360978.1 |
| Coordinates | 1940172..1940504 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A427KRT2 |
| Locus tag | NQ842_RS09160 | Protein ID | WP_020687575.1 |
| Coordinates | 1939914..1940171 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ842_RS09135 (NQ842_09135) | 1935248..1936198 | + | 951 | WP_046888385.1 | HTH-type transcriptional regulator Cbl | - |
| NQ842_RS09140 (NQ842_09140) | 1936241..1936849 | - | 609 | WP_257256759.1 | glutathione S-transferase family protein | - |
| NQ842_RS09145 (NQ842_09145) | 1937020..1937913 | + | 894 | WP_257256760.1 | transcriptional regulator GcvA | - |
| NQ842_RS09150 (NQ842_09150) | 1938040..1938969 | - | 930 | WP_196372580.1 | LysR family transcriptional regulator | - |
| NQ842_RS09155 (NQ842_09155) | 1939111..1939500 | + | 390 | WP_257256761.1 | RidA family protein | - |
| NQ842_RS09160 (NQ842_09160) | 1939914..1940171 | + | 258 | WP_020687575.1 | antitoxin | Antitoxin |
| NQ842_RS09165 (NQ842_09165) | 1940172..1940504 | + | 333 | WP_047360978.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NQ842_RS09170 (NQ842_09170) | 1940743..1944777 | - | 4035 | WP_257256763.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1929623..1944777 | 15154 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11797.68 Da Isoelectric Point: 10.5834
>T253381 WP_047360978.1 NZ_CP102246:1940172-1940504 [Enterobacter cloacae complex sp. R_G8]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKVTRLPVVVPVTSGGNFARTAGFTVSLDGAGTKTMGIIRCDQPRTI
DMAARNGKRLERVPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKVTRLPVVVPVTSGGNFARTAGFTVSLDGAGTKTMGIIRCDQPRTI
DMAARNGKRLERVPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A427KSR1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A427KRT2 |