Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 238135..238751 | Replicon | chromosome |
| Accession | NZ_CP102246 | ||
| Organism | Enterobacter cloacae complex sp. R_G8 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NQ842_RS01160 | Protein ID | WP_080346008.1 |
| Coordinates | 238380..238751 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NQ842_RS01155 | Protein ID | WP_046889539.1 |
| Coordinates | 238135..238377 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ842_RS01130 (NQ842_01130) | 234110..234709 | + | 600 | WP_014833800.1 | glucose-1-phosphatase | - |
| NQ842_RS01135 (NQ842_01135) | 234703..235584 | + | 882 | WP_014833799.1 | virulence factor BrkB family protein | - |
| NQ842_RS01140 (NQ842_01140) | 235581..236018 | + | 438 | WP_118284019.1 | D-aminoacyl-tRNA deacylase | - |
| NQ842_RS01145 (NQ842_01145) | 236063..237004 | + | 942 | WP_013099362.1 | fatty acid biosynthesis protein FabY | - |
| NQ842_RS01150 (NQ842_01150) | 237017..237934 | - | 918 | WP_257256427.1 | alpha/beta hydrolase | - |
| NQ842_RS01155 (NQ842_01155) | 238135..238377 | + | 243 | WP_046889539.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| NQ842_RS01160 (NQ842_01160) | 238380..238751 | + | 372 | WP_080346008.1 | PIN domain-containing protein | Toxin |
| NQ842_RS01165 (NQ842_01165) | 238791..239720 | - | 930 | WP_046889538.1 | formate dehydrogenase accessory protein FdhE | - |
| NQ842_RS01170 (NQ842_01170) | 239717..240352 | - | 636 | WP_014833794.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NQ842_RS01175 (NQ842_01175) | 240349..241251 | - | 903 | WP_014833793.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13612.75 Da Isoelectric Point: 6.6407
>T253379 WP_080346008.1 NZ_CP102246:238380-238751 [Enterobacter cloacae complex sp. R_G8]
MTNMAVFDTNILIDLFNNRVEAADAIDHAAAHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVVTPYQL
MTNMAVFDTNILIDLFNNRVEAADAIDHAAAHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVVTPYQL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|