Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 118029..118654 | Replicon | plasmid p170Kb |
| Accession | NZ_CP102245 | ||
| Organism | Escherichia coli O7:H15 strain ST70 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NQZ80_RS24575 | Protein ID | WP_000911317.1 |
| Coordinates | 118256..118654 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NQZ80_RS24570 | Protein ID | WP_021541611.1 |
| Coordinates | 118029..118256 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ80_RS24570 (118029) | 118029..118256 | + | 228 | WP_021541611.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NQZ80_RS24575 (118256) | 118256..118654 | + | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NQZ80_RS24580 (118663) | 118663..120816 | - | 2154 | WP_021541612.1 | type IV conjugative transfer system coupling protein TraD | - |
| NQZ80_RS24585 (121068) | 121068..121778 | - | 711 | WP_057729491.1 | conjugal transfer complement resistance protein TraT | - |
| NQZ80_RS24590 (121831) | 121831..122328 | - | 498 | WP_032149901.1 | entry exclusion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | papC / papD / hlyB / iroB / iroC / iroD / iroE / iroN / faeJ / faeI / faeH / faeF / faeE / faeD / faeC | 1..170322 | 170322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T253375 WP_000911317.1 NZ_CP102245:118256-118654 [Escherichia coli O7:H15]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|