Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 76084..76609 Replicon plasmid p170Kb
Accession NZ_CP102245
Organism Escherichia coli O7:H15 strain ST70

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NQZ80_RS24365 Protein ID WP_001159871.1
Coordinates 76084..76389 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag NQZ80_RS24370 Protein ID WP_000813639.1
Coordinates 76391..76609 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ80_RS24340 (71974) 71974..72645 - 672 WP_024188661.1 response regulator transcription factor HprR -
NQZ80_RS24345 (72777) 72777..73190 + 414 WP_021541665.1 hydroxyisourate hydrolase -
NQZ80_RS24350 (73289) 73289..74281 + 993 WP_021541666.1 protein-methionine-sulfoxide reductase catalytic subunit MsrP -
NQZ80_RS24355 (74282) 74282..74917 + 636 WP_021541667.1 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ -
NQZ80_RS24360 (75277) 75277..76083 - 807 WP_021541668.1 site-specific integrase -
NQZ80_RS24365 (76084) 76084..76389 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NQZ80_RS24370 (76391) 76391..76609 - 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NQZ80_RS24375 (77205) 77205..77462 + 258 WP_000371885.1 hypothetical protein -
NQZ80_RS24380 (77462) 77462..78052 + 591 WP_000194560.1 hypothetical protein -
NQZ80_RS24385 (78072) 78072..78419 - 348 WP_000142449.1 DUF6404 family protein -
NQZ80_RS24390 (78548) 78548..78883 + 336 WP_001080730.1 colicin 1A immunity protein -
NQZ80_RS24395 (78905) 78905..80785 - 1881 WP_021541669.1 colicin Ia central receptor-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - papC / papD / hlyB / iroB / iroC / iroD / iroE / iroN / faeJ / faeI / faeH / faeF / faeE / faeD / faeC 1..170322 170322


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T253373 WP_001159871.1 NZ_CP102245:c76389-76084 [Escherichia coli O7:H15]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT253373 WP_000813639.1 NZ_CP102245:c76609-76391 [Escherichia coli O7:H15]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References