Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4457448..4457970 | Replicon | chromosome |
| Accession | NZ_CP102244 | ||
| Organism | Escherichia coli O7:H15 strain ST70 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A829L6G8 |
| Locus tag | NQZ80_RS21280 | Protein ID | WP_001105433.1 |
| Coordinates | 4457448..4457738 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V0SC69 |
| Locus tag | NQZ80_RS21285 | Protein ID | WP_000212715.1 |
| Coordinates | 4457728..4457970 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ80_RS21265 (4452638) | 4452638..4454293 | + | 1656 | WP_024216595.1 | alpha,alpha-phosphotrehalase | - |
| NQZ80_RS21270 (4454687) | 4454687..4456825 | + | 2139 | WP_000187799.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NQZ80_RS21275 (4456983) | 4456983..4457447 | + | 465 | WP_001106233.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NQZ80_RS21280 (4457448) | 4457448..4457738 | - | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NQZ80_RS21285 (4457728) | 4457728..4457970 | - | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NQZ80_RS21290 (4458162) | 4458162..4458548 | - | 387 | WP_001232246.1 | cytochrome b562 | - |
| NQZ80_RS21295 (4458732) | 4458732..4460084 | - | 1353 | WP_033560718.1 | metalloprotease PmbA | - |
| NQZ80_RS21300 (4460178) | 4460178..4460729 | + | 552 | WP_000166295.1 | ribosome biogenesis factor YjgA | - |
| NQZ80_RS21305 (4460881) | 4460881..4462254 | - | 1374 | WP_001219792.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T253369 WP_001105433.1 NZ_CP102244:c4457738-4457448 [Escherichia coli O7:H15]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829L6G8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9H4B3 |