Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4230564..4231114 Replicon chromosome
Accession NZ_CP102244
Organism Escherichia coli O7:H15 strain ST70

Toxin (Protein)


Gene name ccdB Uniprot ID A0A244BU83
Locus tag NQZ80_RS20240 Protein ID WP_001160962.1
Coordinates 4230564..4230878 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag NQZ80_RS20245 Protein ID WP_000125566.1
Coordinates 4230881..4231114 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ80_RS20215 (4226239) 4226239..4227525 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
NQZ80_RS20220 (4227525) 4227525..4228514 + 990 WP_000241249.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NQZ80_RS20225 (4228511) 4228511..4229332 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NQZ80_RS20230 (4229335) 4229335..4229712 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NQZ80_RS20235 (4229719) 4229719..4230567 + 849 WP_021556397.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NQZ80_RS20240 (4230564) 4230564..4230878 - 315 WP_001160962.1 CcdB family protein Toxin
NQZ80_RS20245 (4230881) 4230881..4231114 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NQZ80_RS20250 (4231200) 4231200..4231679 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
NQZ80_RS20255 (4231871) 4231871..4233733 - 1863 WP_000377114.1 glutathione-regulated potassium-efflux system protein KefC -
NQZ80_RS20260 (4233726) 4233726..4234256 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NQZ80_RS20265 (4234364) 4234364..4235695 - 1332 WP_001183198.1 MFS transporter -
NQZ80_RS20270 (4235754) 4235754..4236041 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11741.79 Da        Isoelectric Point: 9.0851

>T253367 WP_001160962.1 NZ_CP102244:c4230878-4230564 [Escherichia coli O7:H15]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFIRIRPPERLNTILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT253367 WP_000125566.1 NZ_CP102244:c4231114-4230881 [Escherichia coli O7:H15]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A244BU83

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References