Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3748674..3749292 | Replicon | chromosome |
| Accession | NZ_CP102244 | ||
| Organism | Escherichia coli O7:H15 strain ST70 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NQZ80_RS17990 | Protein ID | WP_001291435.1 |
| Coordinates | 3749074..3749292 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NQZ80_RS17985 | Protein ID | WP_000344800.1 |
| Coordinates | 3748674..3749048 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ80_RS17975 (3743763) | 3743763..3744956 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NQZ80_RS17980 (3744979) | 3744979..3748128 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| NQZ80_RS17985 (3748674) | 3748674..3749048 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NQZ80_RS17990 (3749074) | 3749074..3749292 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NQZ80_RS17995 (3749464) | 3749464..3750015 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NQZ80_RS18000 (3750131) | 3750131..3750601 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NQZ80_RS18005 (3750765) | 3750765..3752315 | + | 1551 | WP_024216672.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NQZ80_RS18010 (3752357) | 3752357..3752710 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NQZ80_RS18020 (3753089) | 3753089..3753400 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NQZ80_RS18025 (3753431) | 3753431..3754003 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253365 WP_001291435.1 NZ_CP102244:3749074-3749292 [Escherichia coli O7:H15]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT253365 WP_000344800.1 NZ_CP102244:3748674-3749048 [Escherichia coli O7:H15]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |