Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2675684..2676322 | Replicon | chromosome |
| Accession | NZ_CP102244 | ||
| Organism | Escherichia coli O7:H15 strain ST70 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
| Locus tag | NQZ80_RS12880 | Protein ID | WP_000813795.1 |
| Coordinates | 2676146..2676322 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NQZ80_RS12875 | Protein ID | WP_001270286.1 |
| Coordinates | 2675684..2676100 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ80_RS12855 (2670836) | 2670836..2671777 | - | 942 | WP_024216494.1 | ABC transporter permease | - |
| NQZ80_RS12860 (2671778) | 2671778..2672791 | - | 1014 | WP_024042137.1 | ABC transporter ATP-binding protein | - |
| NQZ80_RS12865 (2672809) | 2672809..2673954 | - | 1146 | WP_024042138.1 | ABC transporter substrate-binding protein | - |
| NQZ80_RS12870 (2674199) | 2674199..2675605 | - | 1407 | WP_024042139.1 | PLP-dependent aminotransferase family protein | - |
| NQZ80_RS12875 (2675684) | 2675684..2676100 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NQZ80_RS12880 (2676146) | 2676146..2676322 | - | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NQZ80_RS12885 (2676544) | 2676544..2676774 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NQZ80_RS12890 (2676866) | 2676866..2678827 | - | 1962 | WP_024216495.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NQZ80_RS12895 (2678900) | 2678900..2679436 | - | 537 | WP_024044350.1 | DNA-binding transcriptional regulator SutR | - |
| NQZ80_RS12900 (2679528) | 2679528..2680700 | + | 1173 | WP_024044351.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T253364 WP_000813795.1 NZ_CP102244:c2676322-2676146 [Escherichia coli O7:H15]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT253364 WP_001270286.1 NZ_CP102244:c2676100-2675684 [Escherichia coli O7:H15]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|