Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1127617..1128200 | Replicon | chromosome |
| Accession | NZ_CP102244 | ||
| Organism | Escherichia coli O7:H15 strain ST70 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | NQZ80_RS05440 | Protein ID | WP_000254738.1 |
| Coordinates | 1127865..1128200 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | NQZ80_RS05435 | Protein ID | WP_000581937.1 |
| Coordinates | 1127617..1127865 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ80_RS05425 (1123956) | 1123956..1125257 | + | 1302 | WP_024216514.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| NQZ80_RS05430 (1125305) | 1125305..1127539 | + | 2235 | WP_001551562.1 | GTP diphosphokinase | - |
| NQZ80_RS05435 (1127617) | 1127617..1127865 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NQZ80_RS05440 (1127865) | 1127865..1128200 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| NQZ80_RS05445 (1128272) | 1128272..1129063 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NQZ80_RS05450 (1129291) | 1129291..1130928 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| NQZ80_RS05455 (1131016) | 1131016..1132314 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T253357 WP_000254738.1 NZ_CP102244:1127865-1128200 [Escherichia coli O7:H15]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|