Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 970007..970661 | Replicon | chromosome |
| Accession | NZ_CP102244 | ||
| Organism | Escherichia coli O7:H15 strain ST70 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NQZ80_RS04710 | Protein ID | WP_000244781.1 |
| Coordinates | 970254..970661 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NQZ80_RS04705 | Protein ID | WP_000354046.1 |
| Coordinates | 970007..970273 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ80_RS04685 (966095) | 966095..967528 | - | 1434 | WP_001305827.1 | 6-phospho-beta-glucosidase BglA | - |
| NQZ80_RS04690 (967573) | 967573..967884 | + | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
| NQZ80_RS04695 (968048) | 968048..968707 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NQZ80_RS04700 (968784) | 968784..969764 | - | 981 | WP_000886051.1 | tRNA-modifying protein YgfZ | - |
| NQZ80_RS04705 (970007) | 970007..970273 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NQZ80_RS04710 (970254) | 970254..970661 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NQZ80_RS04715 (970701) | 970701..971222 | - | 522 | WP_001055888.1 | flavodoxin FldB | - |
| NQZ80_RS04720 (971334) | 971334..972230 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NQZ80_RS04725 (972255) | 972255..972965 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NQZ80_RS04730 (972971) | 972971..974704 | + | 1734 | WP_000813175.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T253356 WP_000244781.1 NZ_CP102244:970254-970661 [Escherichia coli O7:H15]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|