Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 159069..159681 | Replicon | chromosome |
| Accession | NZ_CP102244 | ||
| Organism | Escherichia coli O7:H15 strain ST70 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9YXE2 |
| Locus tag | NQZ80_RS00695 | Protein ID | WP_000833473.1 |
| Coordinates | 159069..159254 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | L4IWR9 |
| Locus tag | NQZ80_RS00700 | Protein ID | WP_000499744.1 |
| Coordinates | 159271..159681 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ80_RS00680 (154586) | 154586..155737 | + | 1152 | WP_000741506.1 | L-threonine dehydrogenase | - |
| NQZ80_RS00685 (155938) | 155938..157476 | + | 1539 | WP_001469350.1 | aldehyde dehydrogenase AldB | - |
| NQZ80_RS00690 (157517) | 157517..158596 | - | 1080 | WP_000061477.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| NQZ80_RS00695 (159069) | 159069..159254 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NQZ80_RS00700 (159271) | 159271..159681 | + | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NQZ80_RS00705 (159753) | 159753..161717 | - | 1965 | WP_024216364.1 | glycoside hydrolase family 127 protein | - |
| NQZ80_RS00710 (161728) | 161728..163128 | - | 1401 | WP_024216365.1 | MFS transporter | - |
| NQZ80_RS00715 (163354) | 163354..164169 | + | 816 | WP_000891838.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T253352 WP_000833473.1 NZ_CP102244:159069-159254 [Escherichia coli O7:H15]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT253352 WP_000499744.1 NZ_CP102244:159271-159681 [Escherichia coli O7:H15]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|