Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1238442..1239004 | Replicon | chromosome |
| Accession | NZ_CP102197 | ||
| Organism | Schaalia odontolytica strain KHUD_008 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NQK35_RS05445 | Protein ID | WP_257113354.1 |
| Coordinates | 1238442..1238813 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | E6KUL9 |
| Locus tag | NQK35_RS05450 | Protein ID | WP_009213360.1 |
| Coordinates | 1238810..1239004 (-) | Length | 65 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQK35_RS05435 (NQK35_05435) | 1233721..1236621 | - | 2901 | WP_257113351.1 | AAA domain-containing protein | - |
| NQK35_RS05440 (NQK35_05440) | 1236767..1237969 | + | 1203 | WP_257113353.1 | DNA recombination protein RmuC | - |
| NQK35_RS05445 (NQK35_05445) | 1238442..1238813 | - | 372 | WP_257113354.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NQK35_RS05450 (NQK35_05450) | 1238810..1239004 | - | 195 | WP_009213360.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NQK35_RS05455 (NQK35_05455) | 1239709..1240461 | + | 753 | Protein_1056 | IS3 family transposase | - |
| NQK35_RS05460 (NQK35_05460) | 1240674..1241132 | + | 459 | WP_246823576.1 | DUF1440 domain-containing protein | - |
| NQK35_RS05465 (NQK35_05465) | 1241147..1241890 | + | 744 | WP_257113356.1 | Crp/Fnr family transcriptional regulator | - |
| NQK35_RS05470 (NQK35_05470) | 1242324..1242452 | + | 129 | WP_257113358.1 | hypothetical protein | - |
| NQK35_RS05475 (NQK35_05475) | 1242552..1243175 | + | 624 | WP_257113359.1 | transposase | - |
| NQK35_RS05480 (NQK35_05480) | 1243166..1243762 | + | 597 | WP_257113361.1 | DUF3450 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13929.16 Da Isoelectric Point: 6.2302
>T253350 WP_257113354.1 NZ_CP102197:c1238813-1238442 [Schaalia odontolytica]
MRILVDTNVWIDHLRTTEPVLVDLLERDQVCVHQSVITELALGNLKDRLIFLGALERLLIVRNVDDQGVRHFVEERRLWG
RGLSAVDAALLASVVVTPGVSLWTRDKRLRQAARDVSVLAELD
MRILVDTNVWIDHLRTTEPVLVDLLERDQVCVHQSVITELALGNLKDRLIFLGALERLLIVRNVDDQGVRHFVEERRLWG
RGLSAVDAALLASVVVTPGVSLWTRDKRLRQAARDVSVLAELD
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|