253349

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 115415..115974 Replicon plasmid pS270V-2
Accession NZ_CP102196
Organism Klebsiella pneumoniae strain S270v

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag NQZ65_RS29025 Protein ID WP_000421257.1
Coordinates 115415..115690 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag NQZ65_RS29030 Protein ID WP_001178089.1
Coordinates 115690..115974 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ65_RS28990 (110594) 110594..111985 - 1392 WP_000085084.1 SIR2 family protein -
NQZ65_RS28995 (112062) 112062..112586 - 525 WP_050195267.1 recombinase family protein -
NQZ65_RS29000 (112611) 112611..113315 + 705 WP_001067845.1 IS6-like element IS26 family transposase -
NQZ65_RS29005 (113402) 113402..113749 - 348 WP_000142451.1 DUF6404 family protein -
NQZ65_RS29010 (113878) 113878..114213 + 336 WP_001080730.1 colicin 1A immunity protein -
NQZ65_RS29015 (114235) 114235..114603 - 369 Protein_157 colicin-like pore-forming protein -
NQZ65_RS29020 (114668) 114668..115365 + 698 WP_095033700.1 IS1-like element IS1B family transposase -
NQZ65_RS29025 (115415) 115415..115690 - 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ65_RS29030 (115690) 115690..115974 - 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
NQZ65_RS29035 (116618) 116618..117622 - 1005 WP_021546935.1 IS110-like element IS4321 family transposase -
NQZ65_RS29040 (117812) 117812..118516 - 705 WP_001067845.1 IS6-like element IS26 family transposase -
NQZ65_RS29045 (118580) 118580..118816 - 237 Protein_163 DUF3330 domain-containing protein -
NQZ65_RS29050 (119019) 119019..120032 - 1014 WP_000845048.1 class 1 integron integrase IntI1 -
NQZ65_RS29055 (120212) 120212..120766 + 555 WP_032488579.1 aminoglycoside N-acetyltransferase AAC(6')-Ib3 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaTEM-1B / blaKPC-2 / blaSHV-12 / cmlA1 / qacE / blaCTX-M-14 - 1..154868 154868
- inside IScluster/Tn cmlA1 / qacE / blaCTX-M-14 - 105313..138081 32768


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T253349 WP_000421257.1 NZ_CP102196:c115690-115415 [Klebsiella pneumoniae]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT253349 WP_001178089.1 NZ_CP102196:c115974-115690 [Klebsiella pneumoniae]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References