253348

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 95686..96211 Replicon plasmid pS270V-2
Accession NZ_CP102196
Organism Klebsiella pneumoniae strain S270v

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NQZ65_RS28910 Protein ID WP_001159871.1
Coordinates 95686..95991 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1PPD8
Locus tag NQZ65_RS28915 Protein ID WP_000813634.1
Coordinates 95993..96211 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ65_RS28870 (91438) 91438..91665 + 228 WP_001254386.1 conjugal transfer relaxosome protein TraY -
NQZ65_RS28875 (91699) 91699..92064 + 366 WP_021519752.1 type IV conjugative transfer system pilin TraA -
NQZ65_RS28880 (92079) 92079..92390 + 312 WP_000012106.1 type IV conjugative transfer system protein TraL -
NQZ65_RS28885 (92412) 92412..92978 + 567 WP_000399794.1 type IV conjugative transfer system protein TraE -
NQZ65_RS28890 (92965) 92965..93693 + 729 WP_001230787.1 type-F conjugative transfer system secretin TraK -
NQZ65_RS28895 (93693) 93693..94430 + 738 Protein_133 conjugal transfer protein TraB -
NQZ65_RS28900 (94482) 94482..95186 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NQZ65_RS28905 (95251) 95251..95685 - 435 Protein_135 site-specific integrase -
NQZ65_RS28910 (95686) 95686..95991 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NQZ65_RS28915 (95993) 95993..96211 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NQZ65_RS28920 (96770) 96770..97696 + 927 WP_001290414.1 hypothetical protein -
NQZ65_RS28925 (97746) 97746..98000 + 255 WP_000678528.1 hypothetical protein -
NQZ65_RS28930 (98498) 98498..98842 + 345 WP_000792769.1 hypothetical protein -
NQZ65_RS28935 (99016) 99016..100017 - 1002 WP_000785695.1 DUF4238 domain-containing protein -
NQZ65_RS28940 (100590) 100590..100880 - 291 WP_000648897.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaTEM-1B / blaKPC-2 / blaSHV-12 / cmlA1 / qacE / blaCTX-M-14 - 1..154868 154868
- flank IS/Tn - - 94482..95186 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T253348 WP_001159871.1 NZ_CP102196:c95991-95686 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.34 Da        Isoelectric Point: 4.7405

>AT253348 WP_000813634.1 NZ_CP102196:c96211-95993 [Klebsiella pneumoniae]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CQY2

References