253339

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 139352..140022 Replicon plasmid pS270V-1
Accession NZ_CP102193
Organism Klebsiella pneumoniae strain S270v

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NQZ65_RS27190 Protein ID WP_004213072.1
Coordinates 139579..140022 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NQZ65_RS27185 Protein ID WP_004213073.1
Coordinates 139352..139582 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ65_RS27160 (NQZ65_27165) 135575..136474 - 900 WP_004225022.1 nucleotide-binding protein -
NQZ65_RS27165 (NQZ65_27170) 136464..136754 - 291 WP_004213078.1 hypothetical protein -
NQZ65_RS27170 (NQZ65_27175) 137106..137312 + 207 WP_004213077.1 hypothetical protein -
NQZ65_RS27175 (NQZ65_27180) 137302..137595 - 294 WP_004213076.1 hypothetical protein -
NQZ65_RS27180 (NQZ65_27185) 137611..138744 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
NQZ65_RS27185 (NQZ65_27190) 139352..139582 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NQZ65_RS27190 (NQZ65_27195) 139579..140022 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NQZ65_RS27195 (NQZ65_27200) 140171..140422 + 252 WP_186987481.1 hypothetical protein -
NQZ65_RS27200 (NQZ65_27205) 140445..140749 - 305 Protein_146 transposase -
NQZ65_RS27205 (NQZ65_27210) 141166..141801 + 636 Protein_147 mucoid phenotype regulator RmpA2 -
NQZ65_RS27210 (NQZ65_27215) 142319..142722 - 404 Protein_148 GAF domain-containing protein -
NQZ65_RS27215 (NQZ65_27220) 142813..143733 - 921 WP_004213934.1 DUF1471 domain-containing protein -
NQZ65_RS27220 (NQZ65_27225) 143782..144273 - 492 WP_011251327.1 DM13 domain-containing protein -
NQZ65_RS27225 (NQZ65_27230) 144336..144611 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / rmpA / iroN 1..221246 221246


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T253339 WP_004213072.1 NZ_CP102193:139579-140022 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT253339 WP_004213073.1 NZ_CP102193:139352-139582 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References