Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4104386..4105005 Replicon chromosome
Accession NZ_CP102192
Organism Klebsiella pneumoniae strain S270v

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NQZ65_RS20365 Protein ID WP_002892050.1
Coordinates 4104787..4105005 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NQZ65_RS20360 Protein ID WP_002892066.1
Coordinates 4104386..4104760 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ65_RS20350 (NQZ65_20355) 4099538..4100731 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NQZ65_RS20355 (NQZ65_20360) 4100754..4103900 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NQZ65_RS20360 (NQZ65_20365) 4104386..4104760 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NQZ65_RS20365 (NQZ65_20370) 4104787..4105005 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NQZ65_RS20370 (NQZ65_20375) 4105164..4105730 + 567 WP_002892030.1 maltose O-acetyltransferase -
NQZ65_RS20375 (NQZ65_20380) 4105702..4105842 - 141 WP_004147370.1 hypothetical protein -
NQZ65_RS20380 (NQZ65_20385) 4105863..4106333 + 471 WP_002892026.1 YlaC family protein -
NQZ65_RS20385 (NQZ65_20390) 4106308..4107759 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NQZ65_RS20390 (NQZ65_20395) 4107860..4108558 + 699 WP_002892021.1 GNAT family protein -
NQZ65_RS20395 (NQZ65_20400) 4108555..4108695 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NQZ65_RS20400 (NQZ65_20405) 4108695..4108958 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T253333 WP_002892050.1 NZ_CP102192:4104787-4105005 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT253333 WP_002892066.1 NZ_CP102192:4104386-4104760 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References