253319

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 40273..40832 Replicon plasmid pS234-4
Accession NZ_CP102190
Organism Klebsiella pneumoniae strain S234

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag NQZ63_RS29135 Protein ID WP_000421257.1
Coordinates 40273..40548 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag NQZ63_RS29140 Protein ID WP_001178089.1
Coordinates 40548..40832 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ63_RS29100 (35452) 35452..36843 - 1392 WP_000085084.1 SIR2 family protein -
NQZ63_RS29105 (36920) 36920..37444 - 525 WP_050195267.1 recombinase family protein -
NQZ63_RS29110 (37469) 37469..38173 + 705 WP_001067845.1 IS6-like element IS26 family transposase -
NQZ63_RS29115 (38260) 38260..38607 - 348 WP_000142451.1 DUF6404 family protein -
NQZ63_RS29120 (38736) 38736..39071 + 336 WP_001080730.1 colicin 1A immunity protein -
NQZ63_RS29125 (39093) 39093..39461 - 369 Protein_47 colicin-like pore-forming protein -
NQZ63_RS29130 (39526) 39526..40223 + 698 WP_095033700.1 IS1-like element IS1B family transposase -
NQZ63_RS29135 (40273) 40273..40548 - 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ63_RS29140 (40548) 40548..40832 - 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
NQZ63_RS29145 (41476) 41476..42480 - 1005 WP_021546935.1 IS110-like element IS4321 family transposase -
NQZ63_RS29150 (42670) 42670..43374 - 705 WP_001067845.1 IS6-like element IS26 family transposase -
NQZ63_RS29155 (43438) 43438..43674 - 237 Protein_53 DUF3330 domain-containing protein -
NQZ63_RS29160 (43877) 43877..44890 - 1014 WP_000845048.1 class 1 integron integrase IntI1 -
NQZ63_RS29165 (45070) 45070..45624 + 555 WP_032488579.1 aminoglycoside N-acetyltransferase AAC(6')-Ib3 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid cmlA1 / qacE / blaCTX-M-14 / blaTEM-1B - 1..87177 87177
- inside IScluster/Tn cmlA1 / qacE / blaCTX-M-14 / blaTEM-1B - 30171..62828 32657


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T253319 WP_000421257.1 NZ_CP102190:c40548-40273 [Klebsiella pneumoniae]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT253319 WP_001178089.1 NZ_CP102190:c40832-40548 [Klebsiella pneumoniae]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References