Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 3928..4508 | Replicon | plasmid pS234-3 |
Accession | NZ_CP102189 | ||
Organism | Klebsiella pneumoniae strain S234 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | NQZ63_RS28845 | Protein ID | WP_071177730.1 |
Coordinates | 4194..4508 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | NQZ63_RS28840 | Protein ID | WP_000093040.1 |
Coordinates | 3928..4206 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ63_RS28815 (NQZ63_28815) | 1..264 | - | 264 | Protein_0 | cloacin | - |
NQZ63_RS28820 (NQZ63_28820) | 369..1856 | - | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
NQZ63_RS28825 (NQZ63_28825) | 2501..2746 | + | 246 | WP_032440458.1 | hypothetical protein | - |
NQZ63_RS28830 (NQZ63_28830) | 3020..3391 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
NQZ63_RS28835 (NQZ63_28835) | 3388..3753 | + | 366 | WP_072354022.1 | TonB family protein | - |
NQZ63_RS28840 (NQZ63_28840) | 3928..4206 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NQZ63_RS28845 (NQZ63_28845) | 4194..4508 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQZ63_RS28850 (NQZ63_28850) | 4672..5100 | + | 429 | WP_001140599.1 | hypothetical protein | - |
NQZ63_RS28855 (NQZ63_28855) | 5126..5305 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
NQZ63_RS28860 (NQZ63_28860) | 5332..5862 | - | 531 | WP_071177729.1 | hypothetical protein | - |
NQZ63_RS28865 (NQZ63_28865) | 5869..6600 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
NQZ63_RS28870 (NQZ63_28870) | 6600..8564 | - | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..11970 | 11970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T253318 WP_071177730.1 NZ_CP102189:4194-4508 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|