Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 124210..124853 | Replicon | plasmid pS234-2 |
| Accession | NZ_CP102188 | ||
| Organism | Klebsiella pneumoniae strain S234 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | NQZ63_RS28680 | Protein ID | WP_001044770.1 |
| Coordinates | 124437..124853 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | NQZ63_RS28675 | Protein ID | WP_001261282.1 |
| Coordinates | 124210..124440 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ63_RS28640 (119534) | 119534..119839 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| NQZ63_RS28645 (119841) | 119841..120059 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| NQZ63_RS28650 (120618) | 120618..121544 | + | 927 | WP_001290414.1 | hypothetical protein | - |
| NQZ63_RS28655 (121594) | 121594..121848 | + | 255 | WP_000678528.1 | hypothetical protein | - |
| NQZ63_RS28660 (122346) | 122346..122690 | + | 345 | WP_000792769.1 | hypothetical protein | - |
| NQZ63_RS28665 (122864) | 122864..123865 | - | 1002 | WP_000785695.1 | DUF4238 domain-containing protein | - |
| NQZ63_RS28670 (124014) | 124014..124253 | - | 240 | Protein_147 | hypothetical protein | - |
| NQZ63_RS28675 (124210) | 124210..124440 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NQZ63_RS28680 (124437) | 124437..124853 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NQZ63_RS28685 (124927) | 124927..126489 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| NQZ63_RS28690 (126474) | 126474..127496 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| NQZ63_RS28695 (127752) | 127752..128449 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| NQZ63_RS28700 (128478) | 128478..128750 | + | 273 | Protein_153 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | catA2 / dfrA14 / sul2 / qnrS1 / blaLAP-2 / blaKPC-2 / blaSHV-12 / tet(A) | - | 1..146760 | 146760 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T253317 WP_001044770.1 NZ_CP102188:124437-124853 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |