Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 124210..124853 Replicon plasmid pS234-2
Accession NZ_CP102188
Organism Klebsiella pneumoniae strain S234

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NQZ63_RS28680 Protein ID WP_001044770.1
Coordinates 124437..124853 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NQZ63_RS28675 Protein ID WP_001261282.1
Coordinates 124210..124440 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ63_RS28640 (119534) 119534..119839 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NQZ63_RS28645 (119841) 119841..120059 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
NQZ63_RS28650 (120618) 120618..121544 + 927 WP_001290414.1 hypothetical protein -
NQZ63_RS28655 (121594) 121594..121848 + 255 WP_000678528.1 hypothetical protein -
NQZ63_RS28660 (122346) 122346..122690 + 345 WP_000792769.1 hypothetical protein -
NQZ63_RS28665 (122864) 122864..123865 - 1002 WP_000785695.1 DUF4238 domain-containing protein -
NQZ63_RS28670 (124014) 124014..124253 - 240 Protein_147 hypothetical protein -
NQZ63_RS28675 (124210) 124210..124440 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NQZ63_RS28680 (124437) 124437..124853 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NQZ63_RS28685 (124927) 124927..126489 + 1563 WP_004206609.1 AAA family ATPase -
NQZ63_RS28690 (126474) 126474..127496 + 1023 WP_000361404.1 helicase UvrD -
NQZ63_RS28695 (127752) 127752..128449 + 698 WP_223174630.1 IS1 family transposase -
NQZ63_RS28700 (128478) 128478..128750 + 273 Protein_153 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid catA2 / dfrA14 / sul2 / qnrS1 / blaLAP-2 / blaKPC-2 / blaSHV-12 / tet(A) - 1..146760 146760


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T253317 WP_001044770.1 NZ_CP102188:124437-124853 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT253317 WP_001261282.1 NZ_CP102188:124210-124440 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References