253316

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 119534..120059 Replicon plasmid pS234-2
Accession NZ_CP102188
Organism Klebsiella pneumoniae strain S234

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NQZ63_RS28640 Protein ID WP_001159871.1
Coordinates 119534..119839 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1PPD8
Locus tag NQZ63_RS28645 Protein ID WP_000813634.1
Coordinates 119841..120059 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ63_RS28605 (115288) 115288..115932 + 645 WP_000633913.1 division plane positioning ATPase MipZ -
NQZ63_RS28610 (115926) 115926..116201 + 276 WP_000239529.1 hypothetical protein -
NQZ63_RS28615 (116393) 116393..116819 - 427 Protein_136 site-specific integrase -
NQZ63_RS28620 (116999) 116999..117589 + 591 Protein_137 colicin-B -
NQZ63_RS28630 (118358) 118358..118552 - 195 Protein_139 colicin M immunity protein -
NQZ63_RS28635 (118724) 118724..119533 - 810 WP_000016963.1 site-specific integrase -
NQZ63_RS28640 (119534) 119534..119839 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NQZ63_RS28645 (119841) 119841..120059 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NQZ63_RS28650 (120618) 120618..121544 + 927 WP_001290414.1 hypothetical protein -
NQZ63_RS28655 (121594) 121594..121848 + 255 WP_000678528.1 hypothetical protein -
NQZ63_RS28660 (122346) 122346..122690 + 345 WP_000792769.1 hypothetical protein -
NQZ63_RS28665 (122864) 122864..123865 - 1002 WP_000785695.1 DUF4238 domain-containing protein -
NQZ63_RS28670 (124014) 124014..124253 - 240 Protein_147 hypothetical protein -
NQZ63_RS28675 (124210) 124210..124440 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
NQZ63_RS28680 (124437) 124437..124853 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid catA2 / dfrA14 / sul2 / qnrS1 / blaLAP-2 / blaKPC-2 / blaSHV-12 / tet(A) - 1..146760 146760
- flank IS/Tn - - 117605..118108 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T253316 WP_001159871.1 NZ_CP102188:c119839-119534 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.34 Da        Isoelectric Point: 4.7405

>AT253316 WP_000813634.1 NZ_CP102188:c120059-119841 [Klebsiella pneumoniae]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CQY2

References