Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 193005..193915 Replicon plasmid pS234-1
Accession NZ_CP102187
Organism Klebsiella pneumoniae strain S234

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag NQZ63_RS27790 Protein ID WP_004026354.1
Coordinates 193445..193915 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag NQZ63_RS27785 Protein ID WP_004026357.1
Coordinates 193005..193448 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ63_RS27755 (NQZ63_27755) 188040..188441 + 402 WP_214588034.1 LuxR C-terminal-related transcriptional regulator -
NQZ63_RS27760 (NQZ63_27760) 188514..189416 + 903 WP_004213613.1 DMT family inner membrane transporter PEG344 -
NQZ63_RS27765 (NQZ63_27765) 189559..189780 - 222 WP_004213615.1 hypothetical protein -
NQZ63_RS27770 (NQZ63_27770) 189842..191149 - 1308 Protein_206 FepA family TonB-dependent siderophore receptor -
NQZ63_RS27775 (NQZ63_27775) 191215..192195 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
NQZ63_RS27780 (NQZ63_27780) 192401..192904 + 504 Protein_208 DUF4113 domain-containing protein -
NQZ63_RS27785 (NQZ63_27785) 193005..193448 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
NQZ63_RS27790 (NQZ63_27790) 193445..193915 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
NQZ63_RS27795 (NQZ63_27795) 194064..194761 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
NQZ63_RS27800 (NQZ63_27800) 196147..196797 - 651 WP_068893702.1 DUF1173 family protein -
NQZ63_RS27805 (NQZ63_27805) 196830..197096 - 267 WP_223175074.1 DUF1173 family protein -
NQZ63_RS27810 (NQZ63_27810) 197274..197768 + 495 WP_004212794.1 thermonuclease family protein -
NQZ63_RS27815 (NQZ63_27815) 198105..198503 + 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN 1..219806 219806
- inside IScluster/Tn - rmpA / iroN 180219..199954 19735


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T253312 WP_004026354.1 NZ_CP102187:193445-193915 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT253312 WP_004026357.1 NZ_CP102187:193005-193448 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References