Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 153157..153827 | Replicon | plasmid pS234-1 |
| Accession | NZ_CP102187 | ||
| Organism | Klebsiella pneumoniae strain S234 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | NQZ63_RS27545 | Protein ID | WP_004213072.1 |
| Coordinates | 153384..153827 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | NQZ63_RS27540 | Protein ID | WP_004213073.1 |
| Coordinates | 153157..153387 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ63_RS27515 (NQZ63_27515) | 149380..150279 | - | 900 | WP_004225022.1 | nucleotide-binding protein | - |
| NQZ63_RS27520 (NQZ63_27520) | 150269..150559 | - | 291 | WP_004213078.1 | hypothetical protein | - |
| NQZ63_RS27525 (NQZ63_27525) | 150911..151117 | + | 207 | WP_004213077.1 | hypothetical protein | - |
| NQZ63_RS27530 (NQZ63_27530) | 151107..151400 | - | 294 | WP_004213076.1 | hypothetical protein | - |
| NQZ63_RS27535 (NQZ63_27535) | 151416..152549 | - | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| NQZ63_RS27540 (NQZ63_27540) | 153157..153387 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NQZ63_RS27545 (NQZ63_27545) | 153384..153827 | + | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NQZ63_RS27550 (NQZ63_27550) | 153976..154227 | + | 252 | WP_186987481.1 | hypothetical protein | - |
| NQZ63_RS27555 (NQZ63_27555) | 154250..154554 | - | 305 | Protein_163 | transposase | - |
| NQZ63_RS27560 (NQZ63_27560) | 154971..155606 | + | 636 | Protein_164 | mucoid phenotype regulator RmpA2 | - |
| NQZ63_RS27565 (NQZ63_27565) | 156124..156527 | - | 404 | Protein_165 | GAF domain-containing protein | - |
| NQZ63_RS27570 (NQZ63_27570) | 156618..157538 | - | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| NQZ63_RS27575 (NQZ63_27575) | 157587..158078 | - | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| NQZ63_RS27580 (NQZ63_27580) | 158141..158416 | - | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN | 1..219806 | 219806 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T253311 WP_004213072.1 NZ_CP102187:153384-153827 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|