Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 153157..153827 Replicon plasmid pS234-1
Accession NZ_CP102187
Organism Klebsiella pneumoniae strain S234

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NQZ63_RS27545 Protein ID WP_004213072.1
Coordinates 153384..153827 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NQZ63_RS27540 Protein ID WP_004213073.1
Coordinates 153157..153387 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ63_RS27515 (NQZ63_27515) 149380..150279 - 900 WP_004225022.1 nucleotide-binding protein -
NQZ63_RS27520 (NQZ63_27520) 150269..150559 - 291 WP_004213078.1 hypothetical protein -
NQZ63_RS27525 (NQZ63_27525) 150911..151117 + 207 WP_004213077.1 hypothetical protein -
NQZ63_RS27530 (NQZ63_27530) 151107..151400 - 294 WP_004213076.1 hypothetical protein -
NQZ63_RS27535 (NQZ63_27535) 151416..152549 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
NQZ63_RS27540 (NQZ63_27540) 153157..153387 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NQZ63_RS27545 (NQZ63_27545) 153384..153827 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NQZ63_RS27550 (NQZ63_27550) 153976..154227 + 252 WP_186987481.1 hypothetical protein -
NQZ63_RS27555 (NQZ63_27555) 154250..154554 - 305 Protein_163 transposase -
NQZ63_RS27560 (NQZ63_27560) 154971..155606 + 636 Protein_164 mucoid phenotype regulator RmpA2 -
NQZ63_RS27565 (NQZ63_27565) 156124..156527 - 404 Protein_165 GAF domain-containing protein -
NQZ63_RS27570 (NQZ63_27570) 156618..157538 - 921 WP_004213934.1 DUF1471 domain-containing protein -
NQZ63_RS27575 (NQZ63_27575) 157587..158078 - 492 WP_011251327.1 DM13 domain-containing protein -
NQZ63_RS27580 (NQZ63_27580) 158141..158416 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN 1..219806 219806


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T253311 WP_004213072.1 NZ_CP102187:153384-153827 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT253311 WP_004213073.1 NZ_CP102187:153157-153387 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References