Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5344836..5345461 | Replicon | chromosome |
Accession | NZ_CP102186 | ||
Organism | Klebsiella pneumoniae strain S234 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NQZ63_RS26375 | Protein ID | WP_002882817.1 |
Coordinates | 5344836..5345219 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NQZ63_RS26380 | Protein ID | WP_004150355.1 |
Coordinates | 5345219..5345461 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ63_RS26360 (NQZ63_26360) | 5342202..5343104 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NQZ63_RS26365 (NQZ63_26365) | 5343101..5343736 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NQZ63_RS26370 (NQZ63_26370) | 5343733..5344662 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NQZ63_RS26375 (NQZ63_26375) | 5344836..5345219 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NQZ63_RS26380 (NQZ63_26380) | 5345219..5345461 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NQZ63_RS26385 (NQZ63_26385) | 5345666..5346583 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
NQZ63_RS26390 (NQZ63_26390) | 5346597..5347538 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NQZ63_RS26395 (NQZ63_26395) | 5347583..5348020 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NQZ63_RS26400 (NQZ63_26400) | 5348017..5348877 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
NQZ63_RS26405 (NQZ63_26405) | 5348871..5349470 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T253309 WP_002882817.1 NZ_CP102186:c5345219-5344836 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |