Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4161034..4161653 | Replicon | chromosome |
Accession | NZ_CP102186 | ||
Organism | Klebsiella pneumoniae strain S234 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NQZ63_RS20675 | Protein ID | WP_002892050.1 |
Coordinates | 4161435..4161653 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | NQZ63_RS20670 | Protein ID | WP_002892066.1 |
Coordinates | 4161034..4161408 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ63_RS20660 (NQZ63_20660) | 4156186..4157379 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NQZ63_RS20665 (NQZ63_20665) | 4157402..4160548 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NQZ63_RS20670 (NQZ63_20670) | 4161034..4161408 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
NQZ63_RS20675 (NQZ63_20675) | 4161435..4161653 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NQZ63_RS20680 (NQZ63_20680) | 4161812..4162378 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
NQZ63_RS20685 (NQZ63_20685) | 4162350..4162490 | - | 141 | WP_004147370.1 | hypothetical protein | - |
NQZ63_RS20690 (NQZ63_20690) | 4162511..4162981 | + | 471 | WP_002892026.1 | YlaC family protein | - |
NQZ63_RS20695 (NQZ63_20695) | 4162956..4164407 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
NQZ63_RS20700 (NQZ63_20700) | 4164508..4165206 | + | 699 | WP_002892021.1 | GNAT family protein | - |
NQZ63_RS20705 (NQZ63_20705) | 4165203..4165343 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
NQZ63_RS20710 (NQZ63_20710) | 4165343..4165606 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253305 WP_002892050.1 NZ_CP102186:4161435-4161653 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT253305 WP_002892066.1 NZ_CP102186:4161034-4161408 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |