Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 3503170..3503803 | Replicon | chromosome |
| Accession | NZ_CP102182 | ||
| Organism | Ralstonia solanacearum strain Wj644 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NQ322_RS16705 | Protein ID | WP_021155142.1 |
| Coordinates | 3503170..3503583 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q8XUX7 |
| Locus tag | NQ322_RS16710 | Protein ID | WP_011002949.1 |
| Coordinates | 3503570..3503803 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ322_RS16685 | 3498548..3500284 | + | 1737 | WP_016725176.1 | ABC transporter substrate-binding protein | - |
| NQ322_RS16690 | 3500446..3501942 | + | 1497 | WP_016725175.1 | glycerol kinase GlpK | - |
| NQ322_RS16695 | 3502007..3502378 | - | 372 | WP_016725174.1 | hypothetical protein | - |
| NQ322_RS16700 | 3502569..3503195 | + | 627 | WP_016725173.1 | DUF1415 domain-containing protein | - |
| NQ322_RS16705 | 3503170..3503583 | - | 414 | WP_021155142.1 | PIN domain-containing protein | Toxin |
| NQ322_RS16710 | 3503570..3503803 | - | 234 | WP_011002949.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NQ322_RS16715 | 3503860..3505467 | - | 1608 | WP_020832850.1 | glucan biosynthesis protein | - |
| NQ322_RS16720 | 3505662..3506912 | + | 1251 | WP_096761512.1 | AGE family epimerase/isomerase | - |
| NQ322_RS16725 | 3506920..3508215 | + | 1296 | WP_011002952.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15117.45 Da Isoelectric Point: 5.5348
>T253295 WP_021155142.1 NZ_CP102182:c3503583-3503170 [Ralstonia solanacearum]
MPATEAFFDSNVVLYLLSADTAKADATETLLMTGGVVSVQVLNETTHVMRRKLAMPWHAIETVQEAVRAQCRVEPLTLET
HDLGRRIAERYGLSVYDALIVAAALLAGCNVLYSEDMQHGLVIEQHLRIVNPFPARA
MPATEAFFDSNVVLYLLSADTAKADATETLLMTGGVVSVQVLNETTHVMRRKLAMPWHAIETVQEAVRAQCRVEPLTLET
HDLGRRIAERYGLSVYDALIVAAALLAGCNVLYSEDMQHGLVIEQHLRIVNPFPARA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|