Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 1387587..1388220 | Replicon | chromosome |
| Accession | NZ_CP102181 | ||
| Organism | Ralstonia solanacearum strain Bs715 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | M4UIT8 |
| Locus tag | NQ321_RS14740 | Protein ID | WP_016725172.1 |
| Coordinates | 1387587..1388000 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q8XUX7 |
| Locus tag | NQ321_RS14745 | Protein ID | WP_011002949.1 |
| Coordinates | 1387987..1388220 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ321_RS14720 | 1382965..1384701 | + | 1737 | WP_118887843.1 | ABC transporter substrate-binding protein | - |
| NQ321_RS14725 | 1384863..1386359 | + | 1497 | WP_016725175.1 | glycerol kinase GlpK | - |
| NQ321_RS14730 | 1386424..1386795 | - | 372 | WP_016725174.1 | hypothetical protein | - |
| NQ321_RS14735 | 1386986..1387612 | + | 627 | WP_016725173.1 | DUF1415 domain-containing protein | - |
| NQ321_RS14740 | 1387587..1388000 | - | 414 | WP_016725172.1 | PIN domain-containing protein | Toxin |
| NQ321_RS14745 | 1387987..1388220 | - | 234 | WP_011002949.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NQ321_RS14750 | 1388277..1389884 | - | 1608 | WP_020832850.1 | glucan biosynthesis protein | - |
| NQ321_RS14755 | 1390097..1391329 | + | 1233 | WP_021155141.1 | AGE family epimerase/isomerase | - |
| NQ321_RS14760 | 1391337..1392632 | + | 1296 | WP_011002952.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15087.42 Da Isoelectric Point: 5.5348
>T253292 WP_016725172.1 NZ_CP102181:c1388000-1387587 [Ralstonia solanacearum]
MPATEAFFDSNVVLYLLSADTAKADAAETLLMTGGVVSVQVLNETTHVMRRKLAMPWHAIETVQEAVRAQCRVEPLTLET
HDLGRRIAERYGLSVYDALIVAAALLAGCNVLYSEDMQHGLVIEQHLRIVNPFPARA
MPATEAFFDSNVVLYLLSADTAKADAAETLLMTGGVVSVQVLNETTHVMRRKLAMPWHAIETVQEAVRAQCRVEPLTLET
HDLGRRIAERYGLSVYDALIVAAALLAGCNVLYSEDMQHGLVIEQHLRIVNPFPARA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M4UIT8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A223GR76 |