Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 4196249..4196796 | Replicon | chromosome |
| Accession | NZ_CP102179 | ||
| Organism | Pseudomonas canavaninivorans strain B21-020 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LOY40_RS18745 | Protein ID | WP_198796045.1 |
| Coordinates | 4196521..4196796 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A7V8RKA9 |
| Locus tag | LOY40_RS18740 | Protein ID | WP_030141313.1 |
| Coordinates | 4196249..4196521 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOY40_RS18730 (LOY40_18730) | 4192991..4194523 | + | 1533 | WP_030141315.1 | NADH-quinone oxidoreductase subunit M | - |
| LOY40_RS18735 (LOY40_18735) | 4194531..4195994 | + | 1464 | WP_258647916.1 | NADH-quinone oxidoreductase subunit NuoN | - |
| LOY40_RS18740 (LOY40_18740) | 4196249..4196521 | + | 273 | WP_030141313.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| LOY40_RS18745 (LOY40_18745) | 4196521..4196796 | + | 276 | WP_198796045.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LOY40_RS18750 (LOY40_18750) | 4196860..4197969 | + | 1110 | WP_258647917.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| LOY40_RS18755 (LOY40_18755) | 4198168..4198644 | + | 477 | WP_030141310.1 | hemerythrin domain-containing protein | - |
| LOY40_RS18760 (LOY40_18760) | 4198697..4199575 | - | 879 | WP_258647918.1 | LysR family transcriptional regulator | - |
| LOY40_RS18765 (LOY40_18765) | 4199823..4200452 | - | 630 | WP_030141308.1 | isochorismate family cysteine hydrolase YcaC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10658.21 Da Isoelectric Point: 8.5042
>T253288 WP_198796045.1 NZ_CP102179:4196521-4196796 [Pseudomonas canavaninivorans]
MELKWTSKALSDIARLYEFLASVNQPAAARTVQQLTAAPSSLLVNPRIGERLEEFEPRDVRRIQVGHYEMRYEIVGSTLY
LLRLWHTREDR
MELKWTSKALSDIARLYEFLASVNQPAAARTVQQLTAAPSSLLVNPRIGERLEEFEPRDVRRIQVGHYEMRYEIVGSTLY
LLRLWHTREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|