Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 526476..527065 | Replicon | chromosome |
| Accession | NZ_CP102179 | ||
| Organism | Pseudomonas canavaninivorans strain B21-020 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | LOY40_RS02340 | Protein ID | WP_030140979.1 |
| Coordinates | 526476..526781 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LOY40_RS02345 | Protein ID | WP_030140978.1 |
| Coordinates | 526778..527065 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOY40_RS02325 (LOY40_02325) | 522990..524057 | + | 1068 | WP_030140982.1 | uroporphyrinogen decarboxylase | - |
| LOY40_RS02330 (LOY40_02330) | 524106..525380 | - | 1275 | WP_217861077.1 | MFS transporter | - |
| LOY40_RS02335 (LOY40_02335) | 525500..526417 | + | 918 | WP_030140980.1 | LysR family transcriptional regulator | - |
| LOY40_RS02340 (LOY40_02340) | 526476..526781 | + | 306 | WP_030140979.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LOY40_RS02345 (LOY40_02345) | 526778..527065 | + | 288 | WP_030140978.1 | putative addiction module antidote protein | Antitoxin |
| LOY40_RS02350 (LOY40_02350) | 527167..527529 | - | 363 | WP_258648749.1 | alpha/beta hydrolase | - |
| LOY40_RS02355 (LOY40_02355) | 527519..528148 | - | 630 | WP_258648750.1 | alpha/beta hydrolase | - |
| LOY40_RS02360 (LOY40_02360) | 528538..529056 | + | 519 | WP_217861079.1 | hypothetical protein | - |
| LOY40_RS02365 (LOY40_02365) | 529141..529392 | - | 252 | WP_030140975.1 | hypothetical protein | - |
| LOY40_RS02370 (LOY40_02370) | 529419..529664 | - | 246 | Protein_464 | DUF6124 family protein | - |
| LOY40_RS02375 (LOY40_02375) | 530108..530707 | + | 600 | WP_258648751.1 | helix-turn-helix transcriptional regulator | - |
| LOY40_RS02380 (LOY40_02380) | 530697..531575 | + | 879 | WP_258648752.1 | queuosine precursor transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11390.06 Da Isoelectric Point: 10.2763
>T253286 WP_030140979.1 NZ_CP102179:526476-526781 [Pseudomonas canavaninivorans]
MTEIIRSSTFSGWLSKLADSRARMRIQVRVDRMADGNLGDVKALGEGLSEARIDYGPGYRIYFMQQGRQLIILLCGGDKS
SQARDIKQARLIAKSWQEQNP
MTEIIRSSTFSGWLSKLADSRARMRIQVRVDRMADGNLGDVKALGEGLSEARIDYGPGYRIYFMQQGRQLIILLCGGDKS
SQARDIKQARLIAKSWQEQNP
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|