Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 402690..403336 | Replicon | chromosome |
Accession | NZ_CP102179 | ||
Organism | Pseudomonas canavaninivorans strain B21-020 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LOY40_RS01800 | Protein ID | WP_249876528.1 |
Coordinates | 402690..403106 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | LOY40_RS01805 | Protein ID | WP_030141493.1 |
Coordinates | 403106..403336 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOY40_RS01775 (LOY40_01775) | 398116..399345 | - | 1230 | WP_258648723.1 | SAM-dependent methyltransferase | - |
LOY40_RS01780 (LOY40_01780) | 399326..400015 | - | 690 | WP_030141498.1 | ABC transporter permease | - |
LOY40_RS01785 (LOY40_01785) | 400012..400707 | - | 696 | WP_198797081.1 | ABC transporter permease | - |
LOY40_RS01790 (LOY40_01790) | 400787..401542 | - | 756 | WP_030141496.1 | ABC transporter substrate-binding protein | - |
LOY40_RS01795 (LOY40_01795) | 401556..402329 | - | 774 | WP_030141495.1 | ABC transporter ATP-binding protein | - |
LOY40_RS01800 (LOY40_01800) | 402690..403106 | - | 417 | WP_249876528.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
LOY40_RS01805 (LOY40_01805) | 403106..403336 | - | 231 | WP_030141493.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LOY40_RS01810 (LOY40_01810) | 403512..403961 | + | 450 | WP_258648724.1 | carboxypeptidase regulatory-like domain-containing protein | - |
LOY40_RS01815 (LOY40_01815) | 403971..404417 | - | 447 | WP_030141491.1 | hypothetical protein | - |
LOY40_RS01820 (LOY40_01820) | 404458..406692 | - | 2235 | WP_258648725.1 | ATP-binding protein | - |
LOY40_RS01825 (LOY40_01825) | 406689..407294 | - | 606 | WP_258648726.1 | biliverdin-producing heme oxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 390007..403336 | 13329 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15305.06 Da Isoelectric Point: 8.2836
>T253285 WP_249876528.1 NZ_CP102179:c403106-402690 [Pseudomonas canavaninivorans]
MIKFMLDTNICIFTIKNKPQVVREAFIRHHGQLCISAVTLMELIYGAEKSSAPEKNLSVIEGFCARLEVLPFGYDAAAHT
GMIRAELAKIGKPIGPYDQMIAGHARSLGLIVVTNNLKEFERVPGLRVEDWTPLALKP
MIKFMLDTNICIFTIKNKPQVVREAFIRHHGQLCISAVTLMELIYGAEKSSAPEKNLSVIEGFCARLEVLPFGYDAAAHT
GMIRAELAKIGKPIGPYDQMIAGHARSLGLIVVTNNLKEFERVPGLRVEDWTPLALKP
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|