Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 4647389..4647953 | Replicon | chromosome |
| Accession | NZ_CP102177 | ||
| Organism | Pseudomonas corrugata strain B21-055 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LOY64_RS20410 | Protein ID | WP_055137158.1 |
| Coordinates | 4647389..4647676 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LOY64_RS20415 | Protein ID | WP_055137159.1 |
| Coordinates | 4647666..4647953 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOY64_RS20380 (LOY64_20395) | 4642564..4643469 | + | 906 | WP_024776437.1 | hypothetical protein | - |
| LOY64_RS20385 (LOY64_20400) | 4643652..4643852 | - | 201 | WP_024776436.1 | hypothetical protein | - |
| LOY64_RS20390 (LOY64_20405) | 4643963..4644508 | - | 546 | WP_024776435.1 | DUF4410 domain-containing protein | - |
| LOY64_RS20395 (LOY64_20410) | 4644669..4644959 | - | 291 | WP_265068113.1 | hypothetical protein | - |
| LOY64_RS20405 (LOY64_20420) | 4646561..4646992 | - | 432 | WP_055137156.1 | hypothetical protein | - |
| LOY64_RS20410 (LOY64_20425) | 4647389..4647676 | - | 288 | WP_055137158.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LOY64_RS20415 (LOY64_20430) | 4647666..4647953 | - | 288 | WP_055137159.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| LOY64_RS20425 (LOY64_20440) | 4648754..4650037 | + | 1284 | WP_053194367.1 | FAD-binding oxidoreductase | - |
| LOY64_RS20430 (LOY64_20445) | 4650078..4650974 | - | 897 | WP_265068114.1 | PhzF family phenazine biosynthesis protein | - |
| LOY64_RS20435 (LOY64_20450) | 4650987..4651616 | - | 630 | WP_265068115.1 | LysE family translocator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10942.89 Da Isoelectric Point: 10.7498
>T253282 WP_055137158.1 NZ_CP102177:c4647676-4647389 [Pseudomonas corrugata]
MAVEYGVEWDPKALKELRKLDGAIRLQFLRKLQERQAAPRVPGDALHGMKDCYKIKLRGAGYRLVYRVEDKRIVILVLAV
GKRERSSVYNSAKSR
MAVEYGVEWDPKALKELRKLDGAIRLQFLRKLQERQAAPRVPGDALHGMKDCYKIKLRGAGYRLVYRVEDKRIVILVLAV
GKRERSSVYNSAKSR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|