Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 378160..378807 Replicon chromosome
Accession NZ_CP102177
Organism Pseudomonas corrugata strain B21-055

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag LOY64_RS01790 Protein ID WP_265068509.1
Coordinates 378160..378576 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A3M3EIH6
Locus tag LOY64_RS01795 Protein ID WP_024778041.1
Coordinates 378577..378807 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LOY64_RS01765 (LOY64_01765) 373647..374900 - 1254 WP_055136124.1 methyltransferase -
LOY64_RS01770 (LOY64_01770) 374881..375570 - 690 WP_024778036.1 ABC transporter permease -
LOY64_RS01775 (LOY64_01775) 375567..376262 - 696 WP_024778037.1 ABC transporter permease -
LOY64_RS01780 (LOY64_01780) 376341..377096 - 756 WP_024778038.1 ABC transporter substrate-binding protein -
LOY64_RS01785 (LOY64_01785) 377110..377883 - 774 WP_024778039.1 ABC transporter ATP-binding protein -
LOY64_RS01790 (LOY64_01790) 378160..378576 - 417 WP_265068509.1 tRNA(fMet)-specific endonuclease VapC Toxin
LOY64_RS01795 (LOY64_01795) 378577..378807 - 231 WP_024778041.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LOY64_RS01800 (LOY64_01800) 378982..379431 + 450 WP_024778042.1 hypothetical protein -
LOY64_RS01805 (LOY64_01805) 379441..379887 - 447 WP_024778043.1 hypothetical protein -
LOY64_RS01810 (LOY64_01810) 380030..380515 - 486 Protein_353 DUF1016 domain-containing protein -
LOY64_RS01815 (LOY64_01815) 380622..381377 - 756 WP_055137146.1 IS21-like element ISPsy14 family helper ATPase IstB -
LOY64_RS01820 (LOY64_01820) 381398..382912 - 1515 WP_053192610.1 IS21 family transposase -
LOY64_RS01825 (LOY64_01825) 383093..383671 - 579 Protein_356 DUF1016 N-terminal domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 328943..388571 59628


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15238.90 Da        Isoelectric Point: 7.2656

>T253281 WP_265068509.1 NZ_CP102177:c378576-378160 [Pseudomonas corrugata]
MIKFMLDTNICIFTIKNKPQMVREALNLHHGQLCISAVTLMELIYGAEKSCAPERNLAVIEGFCARLEVLPFGYEAAAHT
GMIRAELAKAGKPIGPYDQMIAGHARSLGLIVITNNLKEFERVPGLRTEDWTVAKGPE

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8543.58 Da        Isoelectric Point: 4.3417

>AT253281 WP_024778041.1 NZ_CP102177:c378807-378577 [Pseudomonas corrugata]
MEQTTLFMSNRSQAVRLPKAVAMPSDVKRVDVIAVGRARIITPAGEAWDSWFDGDTVTADFMTDRDQPADQEREPF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3M3EIH6

References