Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 2841507..2842054 | Replicon | chromosome |
Accession | NZ_CP102176 | ||
Organism | Pseudomonas mediterranea strain B21-060 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A6I6QH28 |
Locus tag | LOY71_RS12470 | Protein ID | WP_047698598.1 |
Coordinates | 2841779..2842054 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | LOY71_RS12465 | Protein ID | WP_265086672.1 |
Coordinates | 2841507..2841779 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOY71_RS12445 (LOY71_12450) | 2837459..2838130 | + | 672 | WP_041022045.1 | Bax inhibitor-1/YccA family protein | - |
LOY71_RS12450 (LOY71_12455) | 2838192..2838629 | - | 438 | WP_047698606.1 | Lrp/AsnC family transcriptional regulator | - |
LOY71_RS12455 (LOY71_12460) | 2838763..2839656 | + | 894 | WP_265086712.1 | DMT family transporter | - |
LOY71_RS12460 (LOY71_12465) | 2839663..2841288 | - | 1626 | WP_265086671.1 | NADP-dependent glyceraldehyde-3-phosphate dehydrogenase | - |
LOY71_RS12465 (LOY71_12470) | 2841507..2841779 | + | 273 | WP_265086672.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
LOY71_RS12470 (LOY71_12475) | 2841779..2842054 | + | 276 | WP_047698598.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LOY71_RS12475 (LOY71_12480) | 2842275..2843180 | - | 906 | WP_159285624.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
LOY71_RS12480 (LOY71_12485) | 2843480..2845903 | - | 2424 | WP_230164320.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
LOY71_RS12485 (LOY71_12490) | 2846084..2846884 | - | 801 | WP_230164291.1 | endonuclease/exonuclease/phosphatase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10715.26 Da Isoelectric Point: 8.5042
>T253279 WP_047698598.1 NZ_CP102176:2841779-2842054 [Pseudomonas mediterranea]
MELKWTSKALSDLARLYEFLAAVNQPAAARTVQQLTAAPTTLLDNPRIGERLEEFEPRDVRRIQIGHYEMRYEVVSSTLY
LLRLWHTRENR
MELKWTSKALSDLARLYEFLAAVNQPAAARTVQQLTAAPTTLLDNPRIGERLEEFEPRDVRRIQIGHYEMRYEVVSSTLY
LLRLWHTRENR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|