Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 488096..488685 | Replicon | chromosome |
| Accession | NZ_CP102176 | ||
| Organism | Pseudomonas mediterranea strain B21-060 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | LOY71_RS02145 | Protein ID | WP_081993227.1 |
| Coordinates | 488096..488401 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LOY71_RS02150 | Protein ID | WP_047700469.1 |
| Coordinates | 488398..488685 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOY71_RS02120 (LOY71_02120) | 483185..484030 | + | 846 | WP_159284831.1 | type II secretion system protein GspK | - |
| LOY71_RS02125 (LOY71_02125) | 484030..485133 | + | 1104 | WP_265086426.1 | type II secretion system protein GspL | - |
| LOY71_RS02130 (LOY71_02130) | 485133..485588 | + | 456 | WP_055127146.1 | type II secretion system protein GspM | - |
| LOY71_RS02135 (LOY71_02135) | 485741..487018 | - | 1278 | WP_047700472.1 | MFS transporter | - |
| LOY71_RS02140 (LOY71_02140) | 487138..488073 | + | 936 | WP_047700471.1 | LysR family transcriptional regulator | - |
| LOY71_RS02145 (LOY71_02145) | 488096..488401 | + | 306 | WP_081993227.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LOY71_RS02150 (LOY71_02150) | 488398..488685 | + | 288 | WP_047700469.1 | putative addiction module antidote protein | Antitoxin |
| LOY71_RS02155 (LOY71_02155) | 488733..492749 | - | 4017 | WP_265086427.1 | hypothetical protein | - |
| LOY71_RS02160 (LOY71_02160) | 493060..493506 | - | 447 | WP_047700467.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11432.14 Da Isoelectric Point: 10.0053
>T253277 WP_081993227.1 NZ_CP102176:488096-488401 [Pseudomonas mediterranea]
MTEIIRSCTFSGWLSKLADSRARIRIQVRIDRMADGNLGDVKAIGEGLSEARIDYGPGYRIYFMQQGRQLIILLCGGDKS
SQTRDIKQARLIAKSWQEQNP
MTEIIRSCTFSGWLSKLADSRARIRIQVRIDRMADGNLGDVKAIGEGLSEARIDYGPGYRIYFMQQGRQLIILLCGGDKS
SQTRDIKQARLIAKSWQEQNP
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|