Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4184865..4185429 | Replicon | chromosome |
Accession | NZ_CP102175 | ||
Organism | Pseudomonas corrugata strain B21-061 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | LOY65_RS17935 | Protein ID | WP_055137158.1 |
Coordinates | 4184865..4185152 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | LOY65_RS17940 | Protein ID | WP_055137159.1 |
Coordinates | 4185142..4185429 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LOY65_RS17905 (LOY65_17910) | 4180049..4180954 | + | 906 | WP_024776437.1 | hypothetical protein | - |
LOY65_RS17910 (LOY65_17915) | 4181137..4181337 | - | 201 | WP_024776436.1 | hypothetical protein | - |
LOY65_RS17915 (LOY65_17920) | 4181448..4181993 | - | 546 | WP_053194322.1 | DUF4410 domain-containing protein | - |
LOY65_RS17920 (LOY65_17925) | 4182154..4182444 | - | 291 | WP_024776434.1 | hypothetical protein | - |
LOY65_RS17930 (LOY65_17935) | 4184046..4184477 | - | 432 | WP_055137156.1 | hypothetical protein | - |
LOY65_RS17935 (LOY65_17940) | 4184865..4185152 | - | 288 | WP_055137158.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LOY65_RS17940 (LOY65_17945) | 4185142..4185429 | - | 288 | WP_055137159.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
LOY65_RS17950 (LOY65_17955) | 4186231..4187514 | + | 1284 | WP_053194367.1 | FAD-binding oxidoreductase | - |
LOY65_RS17955 (LOY65_17960) | 4187555..4188451 | - | 897 | WP_238545193.1 | PhzF family phenazine biosynthesis protein | - |
LOY65_RS17960 (LOY65_17965) | 4188464..4189093 | - | 630 | WP_208554830.1 | LysE family translocator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4176416..4185429 | 9013 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10942.89 Da Isoelectric Point: 10.7498
>T253274 WP_055137158.1 NZ_CP102175:c4185152-4184865 [Pseudomonas corrugata]
MAVEYGVEWDPKALKELRKLDGAIRLQFLRKLQERQAAPRVPGDALHGMKDCYKIKLRGAGYRLVYRVEDKRIVILVLAV
GKRERSSVYNSAKSR
MAVEYGVEWDPKALKELRKLDGAIRLQFLRKLQERQAAPRVPGDALHGMKDCYKIKLRGAGYRLVYRVEDKRIVILVLAV
GKRERSSVYNSAKSR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|