Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 330897..331544 Replicon chromosome
Accession NZ_CP102175
Organism Pseudomonas corrugata strain B21-061

Toxin (Protein)


Gene name vapC Uniprot ID A0A3M3EJ95
Locus tag LOY65_RS01470 Protein ID WP_024778040.1
Coordinates 330897..331313 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A3M3EIH6
Locus tag LOY65_RS01475 Protein ID WP_024778041.1
Coordinates 331314..331544 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LOY65_RS01445 (LOY65_01445) 326384..327637 - 1254 WP_055136124.1 methyltransferase -
LOY65_RS01450 (LOY65_01450) 327618..328307 - 690 WP_024778036.1 ABC transporter permease -
LOY65_RS01455 (LOY65_01455) 328304..328999 - 696 WP_024778037.1 ABC transporter permease -
LOY65_RS01460 (LOY65_01460) 329078..329833 - 756 WP_024778038.1 ABC transporter substrate-binding protein -
LOY65_RS01465 (LOY65_01465) 329847..330620 - 774 WP_265075561.1 ABC transporter ATP-binding protein -
LOY65_RS01470 (LOY65_01470) 330897..331313 - 417 WP_024778040.1 tRNA(fMet)-specific endonuclease VapC Toxin
LOY65_RS01475 (LOY65_01475) 331314..331544 - 231 WP_024778041.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LOY65_RS01480 (LOY65_01480) 331719..332168 + 450 WP_024778042.1 hypothetical protein -
LOY65_RS01485 (LOY65_01485) 332178..332624 - 447 WP_024778043.1 hypothetical protein -
LOY65_RS01490 (LOY65_01490) 332767..333825 - 1059 WP_265075562.1 PDDEXK nuclease domain-containing protein -
LOY65_RS01495 (LOY65_01495) 334062..334469 - 408 WP_265068510.1 hypothetical protein -
LOY65_RS01500 (LOY65_01500) 334535..334864 - 330 WP_024778046.1 DHCW motif cupin fold protein -
LOY65_RS01510 (LOY65_01510) 335167..335439 - 273 WP_024778047.1 oxidative damage protection protein -
LOY65_RS01515 (LOY65_01515) 335436..336503 - 1068 WP_265075563.1 A/G-specific adenine glycosylase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 320759..331544 10785


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15272.92 Da        Isoelectric Point: 7.2656

>T253273 WP_024778040.1 NZ_CP102175:c331313-330897 [Pseudomonas corrugata]
MIKFMLDTNICIFTIKNKPQMVREAFNLHHGQLCISAVTLMELIYGAEKSCAPERNLAVIEGFCARLEVLPFGYEAAAHT
GMIRAELAKAGKPIGPYDQMIAGHARSLGLIVITNNLKEFERVPGLRTEDWTVAKGPE

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8543.58 Da        Isoelectric Point: 4.3417

>AT253273 WP_024778041.1 NZ_CP102175:c331544-331314 [Pseudomonas corrugata]
MEQTTLFMSNRSQAVRLPKAVAMPSDVKRVDVIAVGRARIITPAGEAWDSWFDGDTVTADFMTDRDQPADQEREPF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3M3EJ95

Antitoxin

Source ID Structure
AlphaFold DB A0A3M3EIH6

References