Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 4208062..4209104 Replicon chromosome
Accession NZ_CP102174
Organism Pseudomonas aeruginosa strain PA5083

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag NQ602_RS19540 Protein ID WP_003153636.1
Coordinates 4208062..4208637 (-) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag NQ602_RS19545 Protein ID WP_003050245.1
Coordinates 4208634..4209104 (-) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQ602_RS19515 (NQ602_19515) 4204500..4205225 - 726 WP_003050273.1 CBASS effector endonuclease NucC -
NQ602_RS19520 (NQ602_19520) 4205264..4206166 - 903 WP_003090158.1 CBASS oligonucleotide cyclase -
NQ602_RS19525 (NQ602_19525) 4206166..4206666 - 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
NQ602_RS19530 (NQ602_19530) 4206663..4207133 - 471 WP_063305693.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
NQ602_RS19535 (NQ602_19535) 4207130..4208044 - 915 WP_016852809.1 AAA family ATPase -
NQ602_RS19540 (NQ602_19540) 4208062..4208637 - 576 WP_003153636.1 PIN domain-containing protein Toxin
NQ602_RS19545 (NQ602_19545) 4208634..4209104 - 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
NQ602_RS19550 (NQ602_19550) 4209308..4209691 + 384 WP_003090167.1 RAQPRD family integrative conjugative element protein -
NQ602_RS19555 (NQ602_19555) 4209688..4209921 + 234 WP_006226027.1 TIGR03758 family integrating conjugative element protein -
NQ602_RS19560 (NQ602_19560) 4209938..4210297 + 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
NQ602_RS19565 (NQ602_19565) 4210309..4210707 + 399 WP_003050133.1 TIGR03750 family conjugal transfer protein -
NQ602_RS19570 (NQ602_19570) 4210704..4211396 + 693 WP_003090182.1 TIGR03746 family integrating conjugative element protein -
NQ602_RS19575 (NQ602_19575) 4211393..4212304 + 912 WP_006226028.1 TIGR03749 family integrating conjugative element protein -
NQ602_RS19580 (NQ602_19580) 4212294..4213712 + 1419 WP_006226029.1 TIGR03752 family integrating conjugative element protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 4159666..4283679 124013


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21629.78 Da        Isoelectric Point: 5.9995

>T253270 WP_003153636.1 NZ_CP102174:c4208637-4208062 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT253270 WP_003050245.1 NZ_CP102174:c4209104-4208634 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References