Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 183635..184140 | Replicon | chromosome |
| Accession | NZ_CP102174 | ||
| Organism | Pseudomonas aeruginosa strain PA5083 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | NQ602_RS00805 | Protein ID | WP_003083773.1 |
| Coordinates | 183635..183916 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | NQ602_RS00810 | Protein ID | WP_003083775.1 |
| Coordinates | 183913..184140 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ602_RS00780 (NQ602_00780) | 178886..180235 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
| NQ602_RS00785 (NQ602_00785) | 180284..180970 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| NQ602_RS00790 (NQ602_00790) | 181071..181805 | + | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
| NQ602_RS00795 (NQ602_00795) | 181985..182395 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
| NQ602_RS00800 (NQ602_00800) | 182427..183335 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| NQ602_RS00805 (NQ602_00805) | 183635..183916 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| NQ602_RS00810 (NQ602_00810) | 183913..184140 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| NQ602_RS00815 (NQ602_00815) | 184316..184936 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| NQ602_RS00820 (NQ602_00820) | 185037..185537 | + | 501 | WP_003083778.1 | LEA type 2 family protein | - |
| NQ602_RS00825 (NQ602_00825) | 185610..185951 | + | 342 | WP_014603467.1 | zinc ribbon domain-containing protein YjdM | - |
| NQ602_RS00830 (NQ602_00830) | 186033..187460 | - | 1428 | WP_003083784.1 | GABA permease | - |
| NQ602_RS00835 (NQ602_00835) | 187629..189122 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T253267 WP_003083773.1 NZ_CP102174:c183916-183635 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|