Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1967347..1967953 Replicon chromosome
Accession NZ_CP102152
Organism Streptococcus suis strain DNS11

Toxin (Protein)


Gene name parE Uniprot ID A0A0Z8ZB64
Locus tag NQZ88_RS09750 Protein ID WP_012775364.1
Coordinates 1967347..1967676 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID D5AKB4
Locus tag NQZ88_RS09755 Protein ID WP_012028535.1
Coordinates 1967666..1967953 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ88_RS09720 (NQZ88_09720) 1962759..1964489 - 1731 WP_012775361.1 membrane protein -
NQZ88_RS09725 (NQZ88_09725) 1964854..1965726 - 873 WP_012775362.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NQZ88_RS09730 (NQZ88_09730) 1965746..1966276 - 531 WP_009910909.1 DUF1697 domain-containing protein -
NQZ88_RS09735 (NQZ88_09735) 1966290..1966547 - 258 WP_012775363.1 Txe/YoeB family addiction module toxin -
NQZ88_RS09740 (NQZ88_09740) 1966549..1966809 - 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NQZ88_RS09745 (NQZ88_09745) 1966885..1967340 - 456 WP_012028534.1 8-oxo-dGTP diphosphatase -
NQZ88_RS09750 (NQZ88_09750) 1967347..1967676 - 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ88_RS09755 (NQZ88_09755) 1967666..1967953 - 288 WP_012028535.1 hypothetical protein Antitoxin
NQZ88_RS09760 (NQZ88_09760) 1968051..1968419 - 369 WP_012775453.1 hypothetical protein -
NQZ88_RS09765 (NQZ88_09765) 1968412..1968981 - 570 WP_012775700.1 ribonuclease M5 -
NQZ88_RS09770 (NQZ88_09770) 1968965..1969747 - 783 WP_012028536.1 TatD family hydrolase -
NQZ88_RS09775 (NQZ88_09775) 1969854..1969991 - 138 WP_002939016.1 50S ribosomal protein L34 -
NQZ88_RS09780 (NQZ88_09780) 1970159..1971154 - 996 WP_012775367.1 RNA-binding cell elongation regulator Jag/EloR -
NQZ88_RS09785 (NQZ88_09785) 1971174..1971986 - 813 WP_012027897.1 YidC/Oxa1 family membrane protein insertase -
NQZ88_RS09790 (NQZ88_09790) 1971970..1972329 - 360 WP_004194560.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-95)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12562.52 Da        Isoelectric Point: 7.1991

>T253261 WP_012775364.1 NZ_CP102152:c1967676-1967347 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10892.43 Da        Isoelectric Point: 4.3464

>AT253261 WP_012028535.1 NZ_CP102152:c1967953-1967666 [Streptococcus suis]
MITINKDAQVNFKTDSRLLEKAKEVFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GHGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8ZB64

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z9A6F4

References