Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1967347..1967953 | Replicon | chromosome |
| Accession | NZ_CP102152 | ||
| Organism | Streptococcus suis strain DNS11 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A0Z8ZB64 |
| Locus tag | NQZ88_RS09750 | Protein ID | WP_012775364.1 |
| Coordinates | 1967347..1967676 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | D5AKB4 |
| Locus tag | NQZ88_RS09755 | Protein ID | WP_012028535.1 |
| Coordinates | 1967666..1967953 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ88_RS09720 (NQZ88_09720) | 1962759..1964489 | - | 1731 | WP_012775361.1 | membrane protein | - |
| NQZ88_RS09725 (NQZ88_09725) | 1964854..1965726 | - | 873 | WP_012775362.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| NQZ88_RS09730 (NQZ88_09730) | 1965746..1966276 | - | 531 | WP_009910909.1 | DUF1697 domain-containing protein | - |
| NQZ88_RS09735 (NQZ88_09735) | 1966290..1966547 | - | 258 | WP_012775363.1 | Txe/YoeB family addiction module toxin | - |
| NQZ88_RS09740 (NQZ88_09740) | 1966549..1966809 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NQZ88_RS09745 (NQZ88_09745) | 1966885..1967340 | - | 456 | WP_012028534.1 | 8-oxo-dGTP diphosphatase | - |
| NQZ88_RS09750 (NQZ88_09750) | 1967347..1967676 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NQZ88_RS09755 (NQZ88_09755) | 1967666..1967953 | - | 288 | WP_012028535.1 | hypothetical protein | Antitoxin |
| NQZ88_RS09760 (NQZ88_09760) | 1968051..1968419 | - | 369 | WP_012775453.1 | hypothetical protein | - |
| NQZ88_RS09765 (NQZ88_09765) | 1968412..1968981 | - | 570 | WP_012775700.1 | ribonuclease M5 | - |
| NQZ88_RS09770 (NQZ88_09770) | 1968965..1969747 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
| NQZ88_RS09775 (NQZ88_09775) | 1969854..1969991 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
| NQZ88_RS09780 (NQZ88_09780) | 1970159..1971154 | - | 996 | WP_012775367.1 | RNA-binding cell elongation regulator Jag/EloR | - |
| NQZ88_RS09785 (NQZ88_09785) | 1971174..1971986 | - | 813 | WP_012027897.1 | YidC/Oxa1 family membrane protein insertase | - |
| NQZ88_RS09790 (NQZ88_09790) | 1971970..1972329 | - | 360 | WP_004194560.1 | ribonuclease P protein component | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12562.52 Da Isoelectric Point: 7.1991
>T253261 WP_012775364.1 NZ_CP102152:c1967676-1967347 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Z8ZB64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Z9A6F4 |